website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

BACE2 antibody - middle region (ARP46852_P050)

Description of Target:
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Gene Symbol:
BACE2
Official Gene Full Name:
Beta-site APP-cleaving enzyme 2
NCBI Gene Id:
25825
Alias Symbols:
AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Sample Type Confirmation:

BACE2 is supported by BioGPS gene expression data to be expressed in ACHN

Tissue Tool:
Find tissues and cell lines supported to express BACE2.
Protein Accession #:
NP_620477
Nucleotide Accession#:
NM_138992
Swissprot Id:
Q9Y5Z0
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Beta-secretase 2
Protein Size (# AA):
396
Molecular Weight:
37kDa
Application:
WB
Partner Proteins:
APP, BACE2, GGA1, GGA2
Immunogen:
The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
BACE2 antibody - middle region (ARP46852_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 85%
Species Reactivity:
Human, Bovine, Dog, Pig, Horse, Rat, Guinea pig, Mouse, Zebrafish, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-BACE2 antibody
- ARP46852_P050
Peptide Sequence:
Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Blocking Peptide:
For anti-BACE2 antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-BACE2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question