website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BACE2 antibody - middle region (ARP46852_P050)

  • Catalog#: ARP46852_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Beta-site APP-cleaving enzyme 2
    Protein Name:
    Beta-secretase 2
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Description of Target:
    Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express BACE2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express BACE2.
    The immunogen is a synthetic peptide directed towards the middle region of human BACE2
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 92%
    Complete computational species homology data:
    Anti-BACE2 (ARP46852_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; BACE2; APP; GGA1; GGA2;
    Blocking Peptide:
    For anti-BACE2 (ARP46852_P050) antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648)
    Datasheets / Downloads:
    Printable datasheet for anti-BACE2 (ARP46852_P050) antibody
    Sample Type Confirmation:

    BACE2 is supported by BioGPS gene expression data to be expressed in ACHN

    Product Protocols: BACE2 antibody tested with Human Achn Cells (ARP46852_P050)

    Aviva Systems Biology is the original manufacturer of this BACE2 antibody (ARP46852_P050)

    Click here to view the BACE2 antibody Western Blot Protocol

    Product Datasheet Link: BACE2 antibody (ARP46852_P050)

    WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: ACHN

    Western Blot image:

    Description of Target: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s BACE2 antibody (ARP46852_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question