website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BACE2 antibody - middle region (ARP46852_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP46852_P050-FITC Conjugated

ARP46852_P050-HRP Conjugated

ARP46852_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Beta-site APP-cleaving enzyme 2
Protein Name:
Beta-secretase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10048 from Santa Cruz Biotechnology.
Description of Target:
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BACE2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BACE2.
The immunogen is a synthetic peptide directed towards the middle region of human BACE2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-BACE2 (ARP46852_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BACE2 (ARP46852_P050) antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648)
Datasheets / Downloads:
Printable datasheet for anti-BACE2 (ARP46852_P050) antibody
Sample Type Confirmation:

BACE2 is supported by BioGPS gene expression data to be expressed in ACHN

Product Protocols: BACE2 antibody tested with Human Achn Cells (ARP46852_P050)

Aviva Systems Biology is the original manufacturer of this BACE2 antibody (ARP46852_P050)

Click here to view the BACE2 antibody Western Blot Protocol

Product Datasheet Link: BACE2 antibody (ARP46852_P050)

WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN

Western Blot image:

Description of Target: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s BACE2 antibody (ARP46852_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...