website statistics
Account Login 

Aviva Systems Biology office will be closed for Good Friday - 4/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

BACE2 antibody - middle region (ARP46852_P050)

Description of Target:
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Gene Symbol:
Official Gene Full Name:
Beta-site APP-cleaving enzyme 2
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

BACE2 is supported by BioGPS gene expression data to be expressed in ACHN

Tissue Tool:
Find tissues and cell lines supported to express BACE2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Beta-secretase 2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
BACE2 antibody - middle region (ARP46852_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 85%
Species Reactivity:
Human, Bovine, Dog, Pig, Horse, Rat, Guinea pig, Mouse, Zebrafish, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-BACE2 antibody
- ARP46852_P050
Peptide Sequence:
Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Blocking Peptide:
For anti-BACE2 antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for BACE2 antibody (ARP46852)

Product page for BACE2 antibody (ARP46852)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog bace2 antibody; Xenopus laevis bace2 antibody Q7T0Y2 91%
African clawed frog bace2 antibody; Xenopus laevis bace2 antibody Q6PB20 91%
African elephant BACE2 antibody; Loxodonta africana BACE2 antibody G3UER1 100%
African elephant LOC100675691 antibody; Loxodonta africana LOC100675691 antibody G3ST58 84%
Bovine BACE1 antibody; Bos taurus BACE1 antibody Q2HJ40 84%
Bovine Bt.70619 antibody; Bos taurus Bt.70619 antibody E1BKV4 100%
Chicken BACE1 antibody; Gallus gallus BACE1 antibody Q5QHS1 84%
Chicken BACE1 antibody; Gallus gallus BACE1 antibody F1P5X9 84%
Chicken BACE1 antibody; Gallus gallus BACE1 antibody F1N916 84%
Chicken BACE2 antibody; Gallus gallus BACE2 antibody Q5QHS0 100%
Chicken BACE2 antibody; Gallus gallus BACE2 antibody F1NY97 100%
Chicken BACE2 antibody; Gallus gallus BACE2 antibody F1NY96 100%
Chinese hamster Bace1 antibody; Cricetulus griseus Bace1 antibody G3IAK4 84%
Common turkey BACE1 antibody; Meleagris gallopavo BACE1 antibody G1MWK8 84%
Common turkey BACE2 antibody; Meleagris gallopavo BACE2 antibody G3US70 100%
Common turkey BACE2 antibody; Meleagris gallopavo BACE2 antibody G1NP01 100%
Dog BACE2 antibody; Canis familiaris BACE2 antibody F1PMF5 100%
Dog BACE2 antibody; Canis familiaris BACE2 antibody F1PMF4 100%
Dog BACE2 antibody; Canis familiaris BACE2 antibody F1PA64 100%
Dog Cfa.10868 antibody; Canis familiaris Cfa.10868 antibody F1P9Q0 84%
Dog Cfa.10868 antibody; Canis familiaris Cfa.10868 antibody F1P9N8 84%
Duckbill platypus BACE1 antibody; Ornithorhynchus anatinus BACE1 antibody F6WE62 84%
Duckbill platypus BACE2 antibody; Ornithorhynchus anatinus BACE2 antibody F6WGX1 92%
Giant panda LOC100475881 antibody; Ailuropoda melanoleuca LOC100475881 antibody G1LPE5 84%
Gray short-tailed opossum BACE1 antibody; Monodelphis domestica BACE1 antibody F6QP52 84%
Gray short-tailed opossum BACE2 antibody; Monodelphis domestica BACE2 antibody F6W262 92%
Gray short-tailed opossum BACE2 antibody; Monodelphis domestica BACE2 antibody F6SNE9 92%
Green anole LOC100552914 antibody; Anolis carolinensis LOC100552914 antibody G1KET0 92%
Guinea pig BACE1 antibody; Cavia porcellus BACE1 antibody Q1KLR6 84%
Guinea pig BACE2 antibody; Cavia porcellus BACE2 antibody H0VA12 100%
Horse BACE1 antibody; Equus caballus BACE1 antibody F6SGS1 84%
Horse BACE2 antibody; Equus caballus BACE2 antibody F7BPM2 100%
Human BACE1 antibody; Homo sapiens BACE1 antibody P56817 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody P56817-4 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody P56817-3 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody P56817-2 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody Q9P0D2 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody Q8IYC8 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody Q5W9H2 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody H0YF38 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody F8W807 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody E9PE65 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody B7Z3Z4 84%
Human BACE1 antibody; Homo sapiens BACE1 antibody B7Z3K2 84%
Human BACE2 antibody; Homo sapiens BACE2 antibody Q9Y5Z0 100%
Human BACE2 antibody; Homo sapiens BACE2 antibody Q9Y5Z0-5 100%
Human BACE2 antibody; Homo sapiens BACE2 antibody Q9Y5Z0-4 100%
Human BACE2 antibody; Homo sapiens BACE2 antibody Q9Y5Z0-3 100%
Human BACE2 antibody; Homo sapiens BACE2 antibody Q9Y5Z0-2 100%
Little brown bat BACE1 antibody; Myotis lucifugus BACE1 antibody G1PAB0 84%
Little brown bat BACE2 antibody; Myotis lucifugus BACE2 antibody G1PQ90 100%
Lowland gorilla BACE2 antibody; Gorilla gorilla gorilla BACE2 antibody G3RSQ4 100%
Mouse BACE1 antibody; Mus musculus BACE1 antibody P56818 84%
Mouse Bace1 antibody; Mus musculus Bace1 antibody Q9CUU5 84%
Mouse Bace1 antibody; Mus musculus Bace1 antibody Q8C7R1 84%
Mouse Bace1 antibody; Mus musculus Bace1 antibody Q8BQY4 84%
Mouse Bace1 antibody; Mus musculus Bace1 antibody Q69ZQ6 84%
Mouse Bace1 antibody; Mus musculus Bace1 antibody F6TV37 84%
Mouse BACE2 antibody; Mus musculus BACE2 antibody Q9JL18 100%
Northern white-cheeked gibbon BACE1 antibody; Nomascus leucogenys BACE1 antibody G1R6Y6 84%
Northern white-cheeked gibbon BACE2 antibody; Nomascus leucogenys BACE2 antibody G1RB84 100%
Pig BACE1 antibody; Sus scrofa BACE1 antibody F1SB98 84%
Pig BACE2 antibody; Sus scrofa BACE2 antibody F1SG69 100%
Rabbit BACE1 antibody; Oryctolagus cuniculus BACE1 antibody G1U6Z1 84%
Rat BACE1 antibody; Rattus norvegicus BACE1 antibody P56819 84%
Rat Bace1 antibody; Rattus norvegicus Bace1 antibody F1LPH7 84%
Rat BACE2 antibody; Rattus norvegicus BACE2 antibody Q6IE75 100%
Rhesus macaque BACE1 antibody; Macaca mulatta BACE1 antibody F7CQI1 84%
Rhesus macaque BACE2 antibody; Macaca mulatta BACE2 antibody F6YPC0 100%
Rhesus macaque BACE2 antibody; Macaca mulatta BACE2 antibody F6YP80 100%
Rhesus macaque Mmu.3022 antibody; Macaca mulatta Mmu.3022 antibody F7CQE8 84%
Small-eared galago BACE1 antibody; Otolemur garnettii BACE1 antibody H0WUA0 84%
Small-eared galago BACE2 antibody; Otolemur garnettii BACE2 antibody H0WV16 100%
Tasmanian devil BACE1 antibody; Sarcophilus harrisii BACE1 antibody G3WAG5 84%
Tasmanian devil BACE2 antibody; Sarcophilus harrisii BACE2 antibody G3VRN1 92%
Three-spined stickleback BACE1 antibody; Gasterosteus aculeatus BACE1 antibody G3NRK5 84%
Three-spined stickleback BACE2 antibody; Gasterosteus aculeatus BACE2 antibody G3NV69 92%
Western clawed frog bace1 antibody; Xenopus tropicalis bace1 antibody Q0P4T5 84%
Western clawed frog bace2 antibody; Xenopus tropicalis bace2 antibody F6W7Y6 91%
Western clawed frog bace2 antibody; Xenopus tropicalis bace2 antibody B4F734 91%
White-tufted-ear marmoset BACE2 antibody; Callithrix jacchus BACE2 antibody F7HBB0 100%
White-tufted-ear marmoset LOC100389332 antibody; Callithrix jacchus LOC100389332 antibody F7I1I1 84%
White-tufted-ear marmoset LOC100389332 antibody; Callithrix jacchus LOC100389332 antibody F7D6D8 84%
White-tufted-ear marmoset LOC100389332 antibody; Callithrix jacchus LOC100389332 antibody F7D5Z9 84%
White-tufted-ear marmoset LOC100389332 antibody; Callithrix jacchus LOC100389332 antibody F7D5K1 84%
Zebra finch BACE1 antibody; Taeniopygia guttata BACE1 antibody H0YPJ1 84%
Zebra finch BACE2 antibody; Taeniopygia guttata BACE2 antibody H0Z4H6 100%
Zebrafish bace1 antibody; Danio rerio bace1 antibody Q6NZT7 84%
Zebrafish zgc:103530 antibody; Danio rerio zgc:103530 antibody Q5XJ89 92%

Product Protocols: BACE2 antibody tested with Human Achn Cells (ARP46852_P050)

Aviva Systems Biology is the original manufacturer of this BACE2 antibody (ARP46852_P050)

Click here to view the BACE2 antibody Western Blot Protocol

Product Datasheet Link: BACE2 antibody (ARP46852_P050)

WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN

Western Blot image:

Description of Target: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s BACE2 antibody (ARP46852_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question