website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

BACE2 antibody - middle region (ARP46852_P050)

Description of Target:
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Gene Symbol:
BACE2
Official Gene Full Name:
Beta-site APP-cleaving enzyme 2
NCBI Gene Id:
25825
Alias Symbols:
AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Sample Type Confirmation:

BACE2 is supported by BioGPS gene expression data to be expressed in ACHN

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BACE2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BACE2.
Swissprot Id:
Q9Y5Z0
Protein Accession #:
NP_620477
Nucleotide Accession #:
NM_138992
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Beta-secretase 2
Protein Size (# AA):
396
Molecular Weight:
37kDa
Application:
WB
Protein Interactions:
UBC; BACE2; APP; GGA1; GGA2;
Immunogen:
The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
BACE2 antibody - middle region (ARP46852_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 85%
Species Reactivity:
Human, Bovine, Dog, Pig, Horse, Rat, Guinea pig, Mouse, Zebrafish, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-BACE2 antibody
- ARP46852_P050
Peptide Sequence:
Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Blocking Peptide:
For anti-BACE2 antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: BACE2 antibody tested with Human Achn Cells (ARP46852_P050)

Aviva Systems Biology is the original manufacturer of this BACE2 antibody (ARP46852_P050)

Click here to view the BACE2 antibody Western Blot Protocol

Product Datasheet Link: BACE2 antibody (ARP46852_P050)

WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN

Western Blot image:


Description of Target: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s BACE2 antibody (ARP46852_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question