B-RAF Antibody (Phospho-Ser602) (OAAF07516)

Catalog No: OAAF07516 (Formerly GWB-ASB328)

Size:100 ug

Click here to learn more about Aviva's By-Request Conjugation Service.

Western blot analysis of lysates from NIH/3T3 cells treated with EGF 200ng/ml 30', using B-RAF (Phospho-Ser602) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human lymph node, using B-RAF (Phospho-Ser602) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S602 Mouse:S639 Rat:S639
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human B-RAF around the phosphorylation site of Ser602.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: DLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVI
• Concentration: 1mg/ml
• Specificity: B-RAF (Phospho-Ser602) Antibody detects endogenous levels of B-RAF only when phosphorylated at Ser602.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:20000

Target Info

• Gene Symbol: BRAF
• Gene Full Name: B-Raf proto-oncogene, serine/threonine kinase
• Alias Symbols: 94 kDa B-raf protein;B-raf;B-Raf proto-oncogene serine/threonine-protein kinase (p94);B-Raf serine/threonine-protein;BRAF1;B-RAF1;murine sarcoma viral (v-raf) oncogene homolog B1;NS7;p94;proto-oncogene B-Raf;RAFB1;serine/threonine-protein kinase B-raf;v-raf murine sarcoma viral oncogene homolog B;v-raf murine sarcoma viral oncogene homolog B1.
• NCBI Gene Id: 673
• Protein Name: Serine/threonine-protein kinase B-raf
• Description of Target: Protein kinase involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Phosphorylates MAP2K1, and thereby contributes to the MAP kinase signal transduction pathway.
• Uniprot ID: P15056
• Molecular Weight: 84 kDa