website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AVIL antibody - middle region (ARP32811_P050)

  • Catalog#: ARP32811_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP32811_P050-FITC Conjugated

    ARP32811_P050-HRP Conjugated

    ARP32811_P050-Biotin Conjugated

    Gene Symbol:
    AVIL
    NCBI Gene Id:
    10677
    Official Gene Full Name:
    Advillin
    Protein Name:
    Advillin
    Swissprot Id:
    O75366
    Protein Accession #:
    NP_006567
    Nucleotide Accession #:
    NM_006576
    Alias Symbols:
    ADVIL, DKFZp779O1812, DOC6, FLJ12386, MGC133244, p92
    Replacement Item:
    This antibody may replace item sc-72459 from Santa Cruz Biotechnology.
    Description of Target:
    AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
    Protein Size (# AA):
    819
    Molecular Weight:
    92kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express AVIL.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express AVIL.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human AVIL
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
    Complete computational species homology data:
    Anti-AVIL (ARP32811_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; CRK;
    Blocking Peptide:
    For anti-AVIL (ARP32811_P050) antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830)
    Datasheets / Downloads:
    Printable datasheet for anti-AVIL (ARP32811_P050) antibody
    Target Reference:
    Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470

    Product Protocols: AVIL antibody tested with Human Placenta Tissue (ARP32811_P050)

    Aviva Systems Biology is the original manufacturer of this AVIL antibody (ARP32811_P050)

    Click here to view the AVIL antibody Western Blot Protocol

    Product Datasheet Link: AVIL antibody (ARP32811_P050)

    WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: Placenta

    Western Blot image:


    Description of Target: AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s AVIL antibody (ARP32811_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question