website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

AVIL antibody - middle region (ARP32811_P050)

Description of Target:
AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Gene Symbol:
AVIL
Official Gene Full Name:
Advillin
NCBI Gene Id:
10677
Alias Symbols:
ADVIL; DKFZp779O1812; DOC6; FLJ12386; MGC133244; p92
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AVIL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AVIL.
Swissprot Id:
O75366
Protein Accession #:
NP_006567
Nucleotide Accession #:
NM_006576
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Advillin
Protein Size (# AA):
819
Molecular Weight:
92kDa
Application:
WB
Protein Interactions:
UBC; CRK;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human AVIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-AVIL (ARP32811_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%
Species Reactivity:
Bovine, Dog, Horse, Rabbit, Guinea pig, Human, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for anti-AVIL (ARP32811_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP
Blocking Peptide:
For anti-AVIL (ARP32811_P050) antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830)
Target Reference:
Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: AVIL antibody tested with Human Placenta Tissue (ARP32811_P050)

Aviva Systems Biology is the original manufacturer of this AVIL antibody (ARP32811_P050)

Click here to view the AVIL antibody Western Blot Protocol

Product Datasheet Link: AVIL antibody (ARP32811_P050)

WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Placenta

Western Blot image:


Description of Target: AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s AVIL antibody (ARP32811_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question