website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

AVIL antibody - middle region (ARP32811_P050)

Description of Target:
AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Gene Symbol:
AVIL
Official Gene Full Name:
Advillin
NCBI Gene Id:
10677
Alias Symbols:
ADVIL; DKFZp779O1812; DOC6; FLJ12386; MGC133244; p92
Tissue Tool:
Find tissues and cell lines supported to express AVIL.
Protein Accession #:
NP_006567
Nucleotide Accession#:
NM_006576
Swissprot Id:
O75366
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Advillin
Protein Size (# AA):
819
Molecular Weight:
92kDa
Application:
WB
Partner Proteins:
TP53, PPP1CA, PPP1R13L, RELA, SP1, TP53, RELA, SP1, TP53
Immunogen:
The immunogen for anti-AVIL antibody: synthetic peptide directed towards the middle region of human AVIL
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
AVIL antibody - middle region (ARP32811_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%
Species Reactivity:
Bovine, Dog, Horse, Rabbit, Guinea pig, Human, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-AVIL antibody
- ARP32811_P050
Peptide Sequence:
Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP
Blocking Peptide:
For anti-AVIL antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830)
Key Reference:
Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-AVIL antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question