website statistics

Aviva Systems Biology office will be closed for Independence Day - July 4th, 2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AVIL antibody - middle region (ARP32811_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP32811_P050-FITC Conjugated

ARP32811_P050-HRP Conjugated

ARP32811_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ADVIL, DKFZp779O1812, DOC6, FLJ12386, MGC133244, p92
Replacement Item:
This antibody may replace item sc-72459 from Santa Cruz Biotechnology.
Description of Target:
AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AVIL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AVIL.
The immunogen is a synthetic peptide directed towards the middle region of human AVIL
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-AVIL (ARP32811_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-AVIL (ARP32811_P050) antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830)
Datasheets / Downloads:
Printable datasheet for anti-AVIL (ARP32811_P050) antibody
Target Reference:
Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470

Product Protocols: AVIL antibody tested with Human Placenta Tissue (ARP32811_P050)

Aviva Systems Biology is the original manufacturer of this AVIL antibody (ARP32811_P050)

Click here to view the AVIL antibody Western Blot Protocol

Product Datasheet Link: AVIL antibody (ARP32811_P050)

WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Placenta

Western Blot image:

Description of Target: AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s AVIL antibody (ARP32811_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...