website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

AVIL antibody - middle region (ARP32811_P050)

Description of Target:
AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
ADVIL; DKFZp779O1812; DOC6; FLJ12386; MGC133244; p92
Tissue Tool:
Find tissues and cell lines supported to express AVIL.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-AVIL antibody: synthetic peptide directed towards the middle region of human AVIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
AVIL antibody - middle region (ARP32811_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%
Species Reactivity:
Bovine, Dog, Horse, Rabbit, Guinea pig, Human, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-AVIL antibody
- ARP32811_P050
Peptide Sequence:
Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP
Blocking Peptide:
For anti-AVIL antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830)
Target Reference:
Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for AVIL antibody (ARP32811)

Product page for AVIL antibody (ARP32811)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant AVIL antibody; Loxodonta africana AVIL antibody G3T6A1 100%
Bovine AVIL antibody; Bos taurus AVIL antibody F1MMN9 100%
Dog AVIL antibody; Canis familiaris AVIL antibody F1PBL8 100%
Dog AVIL antibody; Canis familiaris AVIL antibody E2R9C8 100%
Guinea pig AVIL antibody; Cavia porcellus AVIL antibody H0VKZ0 100%
Horse AVIL antibody; Equus caballus AVIL antibody F7DP13 100%
Human AVIL antibody; Homo sapiens AVIL antibody O75366 100%
Human AVIL antibody; Homo sapiens AVIL antibody O75366-2 100%
Little brown bat AVIL antibody; Myotis lucifugus AVIL antibody G1P5Y2 92%
Lowland gorilla AVIL antibody; Gorilla gorilla gorilla AVIL antibody G3QGE5 92%
Mouse AVIL antibody; Mus musculus AVIL antibody O88398 92%
Mouse Avil antibody; Mus musculus Avil antibody Q3TBC5 92%
Mouse Avil antibody; Mus musculus Avil antibody Q0VEI6 92%
Northern white-cheeked gibbon AVIL antibody; Nomascus leucogenys AVIL antibody G1S5S8 92%
Rabbit AVIL antibody; Oryctolagus cuniculus AVIL antibody G1T3I1 100%
Rat AVIL antibody; Rattus norvegicus AVIL antibody Q9WU06 84%
Rhesus macaque AVIL antibody; Macaca mulatta AVIL antibody F7GJN7 100%
Small-eared galago AVIL antibody; Otolemur garnettii AVIL antibody H0X6G7 92%
Tasmanian devil AVIL antibody; Sarcophilus harrisii AVIL antibody G3W7C3 91%
White-tufted-ear marmoset AVIL antibody; Callithrix jacchus AVIL antibody F7DRQ4 100%
White-tufted-ear marmoset AVIL antibody; Callithrix jacchus AVIL antibody F7D9H9 100%

Product Protocols: AVIL antibody tested with Human Placenta Tissue (ARP32811_P050)

Aviva Systems Biology is the original manufacturer of this AVIL antibody (ARP32811_P050)

Click here to view the AVIL antibody Western Blot Protocol

Product Datasheet Link: AVIL antibody (ARP32811_P050)

WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Placenta

Western Blot image:

Description of Target: AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s AVIL antibody (ARP32811_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question