ATP10D Antibody - C-terminal region (ARP49516_P050)

Catalog No: ARP49516_P050

WB Suggested Anti-ATP10D Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATP10D
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATP10D (ARP49516_P050) antibody is Catalog # AAP49516 (Previous Catalog # AAPS25403)
• Reference: Flamant,S., (2003) Mamm. Genome 14 (1), 21-30
• Publications:

  Anoctamins, a novel family of ion channels and their role in intracellular calcium signaling. Journal of Cell Science. 125, 4991-4998 (2015). 22946059

Target Info

• Gene Symbol: ATP10D
• Gene Full Name: ATPase, class V, type 10D
• Alias Symbols: ATPVD
• NCBI Gene Id: 57205
• Protein Name: Probable phospholipid-transporting ATPase VD
• Description of Target: ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.
• Uniprot ID: Q9P241
• Protein Accession #: NP_065186
• Nucleotide Accession #: NM_020453
• Protein Size (# AA): 1426
• Molecular Weight: 160kDa
• Protein Interactions: UBC;