Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP32365_P050
Price: $0.00
SKU
ARP32365_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATOH1 (ARP32365_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATOH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 83%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATOH1 (ARP32365_P050) antibody is Catalog # AAP32365 (Previous Catalog # AAPP03354)
Enhanced Validation
SPR Affinity Characterization Avivasheild
ReferenceAragaki,M., (2008) Biochem. Biophys. Res. Commun. 368 (4), 923-929
Publications

Regenerating hair cells in vestibular sensory epithelia from humans. Elife. 7, (2018). 30019672

Description
Gene SymbolATOH1
Gene Full NameAtonal homolog 1 (Drosophila)
Alias SymbolsATH1, HATH1, MATH-1, bHLHa14
NCBI Gene Id474
Protein NameProtein atonal homolog 1
Description of TargetATOH1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ92858
Protein Accession #NP_005163
Nucleotide Accession #NM_005172
Protein Size (# AA)354
Molecular Weight38 kDa
Protein InteractionsHMGB1;
  1. What is the species homology for "ATOH1 Antibody - middle region (ARP32365_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "ATOH1 Antibody - middle region (ARP32365_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATOH1 Antibody - middle region (ARP32365_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATOH1 Antibody - middle region (ARP32365_P050)"?

    This target may also be called "ATH1, HATH1, MATH-1, bHLHa14" in publications.

  5. What is the shipping cost for "ATOH1 Antibody - middle region (ARP32365_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATOH1 Antibody - middle region (ARP32365_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATOH1 Antibody - middle region (ARP32365_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATOH1 Antibody - middle region (ARP32365_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATOH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATOH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATOH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATOH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATOH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATOH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATOH1 Antibody - middle region (ARP32365_P050)
Your Rating
We found other products you might like!