- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
ATF4 Antibody - N-terminal region (ARP37017_P050)
Datasheets/Manuals | Printable datasheet for anti-ATF4 (ARP37017_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Mouse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Mouse: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ATF4 (ARP37017_P050) antibody is Catalog # AAP37017 (Previous Catalog # AAPP09926) |
Reference | Smith,J.A., et al., (2006) J. Virol. 80 (4), 2019-2033 |
Publications | Alger, H. M., Rayavarapu, S. & Nagaraju, K. Measurement of activation of the endoplasmic reticulum stress response in autoimmune myositis. Methods Enzymol. 489, 207-25 (2011). 21266232 Cross-Talk Between FSH and Endoplasmic Reticulum Stress: A Mutually Suppressive Relationship. Reprod Sci. 23, 352-64 (2016). 26342052 Deficiency of VCP-Interacting Membrane Selenoprotein (VIMP) Leads to G1 Cell Cycle Arrest and Cell Death in MIN6 Insulinoma Cells. Cell Physiol Biochem. 51, 2185-2197 (2018). 30537728 Drivas, T. G., Holzbaur, E. L. F. & Bennett, J. Disruption of CEP290 microtubule/membrane-binding domains causes retinal degeneration. J. Clin. Invest. 123, 4525-39 (2013). 24051377 Glutathione S-Transferase P-Mediated Protein S-Glutathionylation of Resident Endoplasmic Reticulum Proteins Influences Sensitivity to Drug-Induced Unfolded Protein Response. Antioxid. Redox Signal. 26, 247-261 (2017). 26838680 IER3IP1 deficiency leads to increased β-cell death and decreased β-cell proliferation. Oncotarget. 8, 56768-56779 (2017). 28915629 Mast Cells Induce Blood Brain Barrier Damage in SCD by Causing Endoplasmic Reticulum Stress in the Endothelium. Front Cell Neurosci. 13, 56 (2019). 30837844 Methods for monitoring endoplasmic reticulum stress and the unfolded protein response. Int J Cell Biol. 2010, 830307 (2010). 20169136 Oligodendrocyte Death in Pelizaeus-Merzbacher Disease Is Rescued by Iron Chelation. Cell Stem Cell. 25, 531-541.e6 (2019). 31585094 Schneeberger, M. et al. Mitofusin 2 in POMC Neurons Connects ER Stress with Leptin Resistance and Energy Imbalance. Cell 155, 172-87 (2013). 24074867 The integrated stress response in hypoxia-induced diffuse white matter injury. J Neurosci. , (2017). 28720571 |
Description |
Gene Symbol | ATF4 |
---|---|
Gene Full Name | Activating transcription factor 4 |
Alias Symbols | Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67 |
NCBI Gene Id | 11911 |
Protein Name | Activating transcriptionn factor 4 EMBL CAA43723.1 |
Description of Target | Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE's as a homodimer. |
Uniprot ID | Q61328 |
Protein Accession # | NP_033846 |
Nucleotide Accession # | NM_009716 |
Protein Size (# AA) | 381 |
Molecular Weight | 42kDa |
Protein Interactions | Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Mouse".
-
How long will it take to receive "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ATF4 Antibody - N-terminal region (ARP37017_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
This target may also be called "Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67" in publications.
-
What is the shipping cost for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "42kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ATF4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ATF4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ATF4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ATF4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ATF4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ATF4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.