Catalog No: ARP51357_T100
Price: $0.00
SKU
ARP51357_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ASPH (ARP51357_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ASPH
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Horse: 83%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE
Concentration1.0 mg/ml
Blocking PeptideFor anti-ASPH (ARP51357_T100) antibody is Catalog # AAP51357 (Previous Catalog # AAPS22605)
Sample Type Confirmation

There is BioGPS gene expression data showing that ASPH is expressed in HepG2

ReferenceXian,Z.H., (2006) Mod. Pathol. 19 (2), 280-286
Gene SymbolASPH
Gene Full NameAspartate beta-hydroxylase
Alias SymbolsAAH, BAH, HAAH, JCTN, FDLAB, junctin, CASQ2BP1
NCBI Gene Id444
Protein NameAspartyl/asparaginyl beta-hydroxylase
Description of TargetASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
Uniprot IDQ9NRI0
Protein Accession #NP_064549
Nucleotide Accession #NM_020164
Protein Size (# AA)225
Molecular Weight25kDa
Protein InteractionsASNA1; TARDBP; IQCB1; UBC; NOS2; Htt; APP; CUL3; SQSTM1; TRDN;
  1. What is the species homology for "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ASPH Antibody - N-terminal region (ARP51357_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    This target may also be called "AAH, BAH, HAAH, JCTN, FDLAB, junctin, CASQ2BP1" in publications.

  5. What is the shipping cost for "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ASPH Antibody - N-terminal region (ARP51357_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ASPH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ASPH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ASPH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ASPH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ASPH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ASPH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ASPH Antibody - N-terminal region (ARP51357_T100)
Your Rating
We found other products you might like!