website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ARMC3 antibody - middle region (ARP55626_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP55626_P050-FITC Conjugated

ARP55626_P050-HRP Conjugated

ARP55626_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Armadillo repeat containing 3
Protein Name:
Armadillo repeat-containing protein 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ25845, FLJ32827, RP11-300B11.1, CT81, KU-CT-1
Replacement Item:
This antibody may replace item sc-104818 from Santa Cruz Biotechnology.
Description of Target:
The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARMC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARMC3.
The immunogen is a synthetic peptide directed towards the middle region of human ARMC3
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 79%; Rat: 86%
Complete computational species homology data:
Anti-ARMC3 (ARP55626_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ARMC3 (ARP55626_P050) antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003)
Datasheets / Downloads:
Printable datasheet for anti-ARMC3 (ARP55626_P050) antibody
Target Reference:
Li,X., (2006) Genetika 42 (7), 999-1003

Product Protocols: ARMC3 antibody tested with Human Hepg2 Cells (ARP55626_P050)

Aviva Systems Biology is the original manufacturer of this ARMC3 antibody (ARP55626_P050)

Click here to view the ARMC3 antibody Western Blot Protocol

Product Datasheet Link: ARMC3 antibody (ARP55626_P050)

WB Suggested Anti-ARMC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:

Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ARMC3 antibody (ARP55626_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question