website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ARMC3 antibody - middle region (ARP55626_P050)

Description of Target:
The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831
Gene Symbol:
Official Gene Full Name:
Armadillo repeat containing 3
NCBI Gene Id:
Alias Symbols:
FLJ25845; FLJ32827; RP11-300B11.1; CT81; KU-CT-1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARMC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARMC3.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Armadillo repeat-containing protein 3
Protein Size (# AA):
Molecular Weight:
The immunogen is a synthetic peptide directed towards the middle region of human ARMC3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-ARMC3 (ARP55626_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 79%; Rat: 86%
Species Reactivity:
Cow; Dog; Horse; Human; Mouse; Pig; Rat
Datasheets / Downloads:
Printable datasheet for anti-ARMC3 (ARP55626_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
Blocking Peptide:
For anti-ARMC3 (ARP55626_P050) antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003)
Target Reference:
Li,X., (2006) Genetika 42 (7), 999-1003
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ARMC3 antibody tested with Human Hepg2 Cells (ARP55626_P050)

Aviva Systems Biology is the original manufacturer of this ARMC3 antibody (ARP55626_P050)

Click here to view the ARMC3 antibody Western Blot Protocol

Product Datasheet Link: ARMC3 antibody (ARP55626_P050)

WB Suggested Anti-ARMC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:

Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ARMC3 antibody (ARP55626_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question