website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ARMC3 antibody - middle region (ARP55626_P050)

Description of Target:
The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831
Gene Symbol:
Official Gene Full Name:
Armadillo repeat containing 3
NCBI Gene Id:
Alias Symbols:
FLJ25845; FLJ32827; RP11-300B11.1; CT81; KU-CT-1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARMC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARMC3.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Armadillo repeat-containing protein 3
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-ARMC3 antibody: synthetic peptide directed towards the middle region of human ARMC3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
ARMC3 antibody - middle region (ARP55626_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 86%; Horse: 86%; Dog: 79%; Pig: 79%; Mouse: 79%; Bovine: 79%
Species Reactivity:
Human, Rat, Horse, Mouse, Bovine, Dog, Pig
Datasheets / Downloads:
Printable datasheet for
anti-ARMC3 antibody
- ARP55626_P050
Peptide Sequence:
Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
Blocking Peptide:
For anti-ARMC3 antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003)
Target Reference:
Li,X., (2006) Genetika 42 (7), 999-1003
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for ARMC3 antibody (ARP55626)

Product page for ARMC3 antibody (ARP55626)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant ARMC3 antibody; Loxodonta africana ARMC3 antibody G3T093 78%
Bovine BT.34113 antibody; Bos taurus BT.34113 antibody E1BPV0 78%
Dog ARMC3 antibody; Canis familiaris ARMC3 antibody F1PPG7 78%
Dog ARMC3 antibody; Canis familiaris ARMC3 antibody F1PCP1 78%
Horse ARMC3 antibody; Equus caballus ARMC3 antibody F7BB13 85%
Human ARMC3 antibody; Homo sapiens ARMC3 antibody Q5W041 100%
Human ARMC3 antibody; Homo sapiens ARMC3 antibody Q5W041-4 100%
Human ARMC3 antibody; Homo sapiens ARMC3 antibody Q5W041-3 100%
Human ARMC3 antibody; Homo sapiens ARMC3 antibody B4DXS3 100%
Little brown bat ARMC3 antibody; Myotis lucifugus ARMC3 antibody G1NVZ2 85%
Lowland gorilla ARMC3 antibody; Gorilla gorilla gorilla ARMC3 antibody G3RUM4 100%
Lowland gorilla ARMC3 antibody; Gorilla gorilla gorilla ARMC3 antibody G3RIC0 100%
Mouse ARMC3 antibody; Mus musculus ARMC3 antibody A2AU72 78%
Mouse ARMC3 antibody; Mus musculus ARMC3 antibody A2AU72-2 78%
Mouse Armc3 antibody; Mus musculus Armc3 antibody E9Q7Z4 78%
Mouse Armc3 antibody; Mus musculus Armc3 antibody B7ZN53 78%
Mouse Armc3 antibody; Mus musculus Armc3 antibody B2RWT0 78%
Mouse Armc3 antibody; Mus musculus Armc3 antibody A2AU71 78%
Northern white-cheeked gibbon ARMC3 antibody; Nomascus leucogenys ARMC3 antibody G1RQY3 100%
Pig ARMC3 antibody; Sus scrofa ARMC3 antibody F1RVI7 78%
Rat LOC100361506 antibody; Rattus norvegicus LOC100361506 antibody D3ZVG5 85%
Rat LOC100364294 antibody; Rattus norvegicus LOC100364294 antibody D3ZPL8 85%
Rhesus macaque ARMC3 antibody; Macaca mulatta ARMC3 antibody F7D9L3 100%
Small-eared galago ARMC3 antibody; Otolemur garnettii ARMC3 antibody H0X3R1 85%
White-tufted-ear marmoset ARMC3 antibody; Callithrix jacchus ARMC3 antibody F7I261 92%
White-tufted-ear marmoset ARMC3 antibody; Callithrix jacchus ARMC3 antibody F7I233 92%

Product Protocols: ARMC3 antibody tested with Human Hepg2 Cells (ARP55626_P050)

Aviva Systems Biology is the original manufacturer of this ARMC3 antibody (ARP55626_P050)

Click here to view the ARMC3 antibody Western Blot Protocol

Product Datasheet Link: ARMC3 antibody (ARP55626_P050)

WB Suggested Anti-ARMC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:

Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ARMC3 antibody (ARP55626_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question