website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ARMC3 antibody - middle region (ARP55626_P050)

Description of Target:
The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831
Gene Symbol:
Official Gene Full Name:
Armadillo repeat containing 3
NCBI Gene Id:
Alias Symbols:
FLJ25845; FLJ32827; RP11-300B11.1; CT81; KU-CT-1
Tissue Tool:
Find tissues and cell lines supported to express ARMC3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Armadillo repeat-containing protein 3
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-ARMC3 antibody: synthetic peptide directed towards the middle region of human ARMC3
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
ARMC3 antibody - middle region (ARP55626_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 86%; Horse: 86%; Dog: 79%; Pig: 79%; Mouse: 79%; Bovine: 79%
Species Reactivity:
Human, Rat, Horse, Mouse, Bovine, Dog, Pig
Datasheets / Downloads:
Printable datasheet for
anti-ARMC3 antibody
- ARP55626_P050
Peptide Sequence:
Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
Blocking Peptide:
For anti-ARMC3 antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003)
Key Reference:
Li,X., (2006) Genetika 42 (7), 999-1003
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ARMC3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question