website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ARMC3 antibody - middle region (ARP55626_P050)

  • Catalog#: ARP55626_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Armadillo repeat containing 3
    Protein Name:
    Armadillo repeat-containing protein 3
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    FLJ25845, FLJ32827, RP11-300B11.1, CT81, KU-CT-1
    Description of Target:
    The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express ARMC3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express ARMC3.
    The immunogen is a synthetic peptide directed towards the middle region of human ARMC3
    Species Reactivity:
    Cow, Dog, Horse, Human, Mouse, Pig, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 79%; Rat: 86%
    Complete computational species homology data:
    Anti-ARMC3 (ARP55626_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-ARMC3 (ARP55626_P050) antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003)
    Datasheets / Downloads:
    Printable datasheet for anti-ARMC3 (ARP55626_P050) antibody
    Target Reference:
    Li,X., (2006) Genetika 42 (7), 999-1003

    Product Protocols: ARMC3 antibody tested with Human Hepg2 Cells (ARP55626_P050)

    Aviva Systems Biology is the original manufacturer of this ARMC3 antibody (ARP55626_P050)

    Click here to view the ARMC3 antibody Western Blot Protocol

    Product Datasheet Link: ARMC3 antibody (ARP55626_P050)

    WB Suggested Anti-ARMC3 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:1562500
    Positive Control: HepG2

    Western Blot image:

    Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s ARMC3 antibody (ARP55626_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question