ARL5A Antibody - middle region (ARP55757_P050)

Catalog No: ARP55757_P050

WB Suggested Anti-ARL5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL5A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 91%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARL5A (ARP55757_P050) antibody is Catalog # AAP55757 (Previous Catalog # AAPP36622)
• Reference: Wang,Z.X., (2005) Biochem. Biophys. Res. Commun. 332 (3), 640-645

Target Info

• Gene Symbol: ARL5A
• Gene Full Name: ADP-ribosylation factor-like 5A
• Alias Symbols: ARL5, ARFLP5
• NCBI Gene Id: 26225
• Protein Name: ADP-ribosylation factor-like protein 5A
• Description of Target: ARL5A lacks ADP-ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
• Uniprot ID: Q9Y689
• Protein Accession #: NP_036229
• Nucleotide Accession #: NM_012097
• Protein Size (# AA): 179
• Molecular Weight: 20kDa
• Protein Interactions: APP; ELAVL1; CBX1; CBX5; KPNA2; NMT1; CBX3;