ARID4A Antibody - C-terminal region (ARP33088_T100)

Catalog No: ARP33088_T100

WB Suggested Anti-ARID4A Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARID4A
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ARID4A (ARP33088_T100) antibody is Catalog # AAP33088 (Previous Catalog # AAPP04121)
• Reference: Meehan,W.J., et al., (2004) J. Biol. Chem. 279 (2), 1562-1569
• Publications:

  Kondou, H. et al. Sodium-coupled neutral amino acid transporter 4 functions as a regulator of protein synthesis during liver development. Hepatol. Res. (2013). doi:10.1111/hepr.12069 23607685

Target Info

• Gene Symbol: ARID4A
• Gene Full Name: AT rich interactive domain 4A (RBP1-like)
• Alias Symbols: RBP1, RBBP1, RBP-1, RBBP-1
• NCBI Gene Id: 5926
• Protein Name: AT-rich interactive domain-containing protein 4A
• Description of Target: ARID4A encodes a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described.
• Uniprot ID: P29374
• Protein Accession #: NP_002883
• Nucleotide Accession #: NM_002892
• Protein Size (# AA): 1257
• Molecular Weight: 143kDa
• Protein Interactions: SUMO2; SUMO1; HDAC1; BRMS1; HIST2H3C; HIST4H4; UBC; CDK2; CDK1; CCNE1; CCNB1; CCNA2; CCND1; CDK4; SIN3A; SAP30; RB1; SIN3B; RBBP7; RBBP4; ARID4B; HDAC3; EID1; HDAC2; ING2; RBL1;