website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

ARC antibody - middle region (ARP36563_P050)

Description of Target:
ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Gene Symbol:
ARC
Official Gene Full Name:
Activity-regulated cytoskeleton-associated protein
NCBI Gene Id:
23237
Alias Symbols:
KIAA0278; Arg3.1
Tissue Tool:
Find tissues and cell lines supported to express ARC.
Protein Accession #:
NP_056008
Nucleotide Accession#:
NM_015193
Swissprot Id:
Q7LC44
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Activity-regulated cytoskeleton-associated protein
Protein Size (# AA):
396
Molecular Weight:
45kDa
Application:
IHC, WB
Partner Proteins:
NDN, NR1I2, NDN, STAR
Immunogen:
The immunogen for anti-ARC antibody: synthetic peptide directed towards the middle region of human ARC
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
ARC antibody - middle region (ARP36563_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Guinea pig, Goat, Rat, Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-ARC antibody
- ARP36563_P050
Peptide Sequence:
Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Blocking Peptide:
For anti-ARC antibody is Catalog # AAP36563 (Previous Catalog # AAPP07714)
Key Reference:
Foo,R.S., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (52), 20826-20831
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ARC antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question