website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ARC antibody - middle region (ARP36563_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Activity-regulated cytoskeleton-associated protein
Protein Name:
Activity-regulated cytoskeleton-associated protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA0278, Arg3.1
Description of Target:
ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARC.
The immunogen is a synthetic peptide directed towards the middle region of human ARC
Species Reactivity:
Cow, Goat, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-ARC (ARP36563_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ARC (ARP36563_P050) antibody is Catalog # AAP36563 (Previous Catalog # AAPP07714)
Datasheets / Downloads:
Printable datasheet for anti-ARC (ARP36563_P050) antibody
Target Reference:
Foo,R.S., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (52), 20826-20831

Product Protocols: ARC antibody tested with Human Transfected 293T Cells (ARP36563_P050)

Aviva Systems Biology is the original manufacturer of this ARC antibody (ARP36563_P050)

Click here to view the ARC antibody Western Blot Protocol

Product Datasheet Link: ARC antibody (ARP36563_P050)

WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:

Description of Target: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ARC antibody (ARP36563_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question