website statistics
Account Login 

Aviva Systems Biology office will be closed for Good Friday - 4/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ARC antibody - middle region (ARP36563_P050)

Description of Target:
ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Gene Symbol:
Official Gene Full Name:
Activity-regulated cytoskeleton-associated protein
NCBI Gene Id:
Alias Symbols:
KIAA0278; Arg3.1
Tissue Tool:
Find tissues and cell lines supported to express ARC.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Activity-regulated cytoskeleton-associated protein
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-ARC antibody: synthetic peptide directed towards the middle region of human ARC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
ARC antibody - middle region (ARP36563_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Guinea pig, Goat, Rat, Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-ARC antibody
- ARP36563_P050
Peptide Sequence:
Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Blocking Peptide:
For anti-ARC antibody is Catalog # AAP36563 (Previous Catalog # AAPP07714)
Target Reference:
Foo,R.S., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (52), 20826-20831
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for ARC antibody (ARP36563)

Product page for ARC antibody (ARP36563)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant ARC antibody; Loxodonta africana ARC antibody G3U004 100%
Bovine ARC antibody; Bos taurus ARC antibody G5E5R8 100%
Chicken ARC antibody; Gallus gallus ARC antibody Q8AWC3 92%
Common turkey LOC100540431 antibody; Meleagris gallopavo LOC100540431 antibody G1NJY6 92%
Dinodon rufozonatum Arc3.1 antibody D9J1S1 92%
Duckbill platypus LOC100082048 antibody; Ornithorhynchus anatinus LOC100082048 antibody F6WIR2 100%
Gray short-tailed opossum ARC antibody; Monodelphis domestica ARC antibody F6S1C3 100%
Guinea pig LOC100724032 antibody; Cavia porcellus LOC100724032 antibody H0W8B8 100%
Human ARC antibody; Homo sapiens ARC antibody Q7LC44 100%
Lowland gorilla ARC antibody; Gorilla gorilla gorilla ARC antibody G3QPU1 100%
Mouse ARC antibody; Mus musculus ARC antibody Q9WV31 100%
Rat ARC antibody; Rattus norvegicus ARC antibody Q63053 100%
Rhesus macaque LOC702690 antibody; Macaca mulatta LOC702690 antibody F7A2Y9 100%
Small-eared galago ARC antibody; Otolemur garnettii ARC antibody H0XN91 100%
Tasmanian devil ARC antibody; Sarcophilus harrisii ARC antibody G3WYV7 100%
White-tufted-ear marmoset ARC antibody; Callithrix jacchus ARC antibody F7IGU9 100%
White-tufted-ear marmoset ARC antibody; Callithrix jacchus ARC antibody F7BU20 100%
Zebra finch Arc antibody; Taeniopygia guttata Arc antibody A0N0T4 91%
Zebra finch Tgu.6790 antibody; Taeniopygia guttata Tgu.6790 antibody H0ZR57 92%

Product Protocols: ARC antibody tested with Human Transfected 293T Cells (ARP36563_P050)

Aviva Systems Biology is the original manufacturer of this ARC antibody (ARP36563_P050)

Click here to view the ARC antibody Western Blot Protocol

Product Datasheet Link: ARC antibody (ARP36563_P050)

WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:

Description of Target: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ARC antibody (ARP36563_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question