SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54283_P050
Price: $0.00
SKU
ARP54283_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

APOE Antibody - N-terminal region (ARP54283_P050)

Datasheets/ManualsPrintable datasheet for anti-APOE (ARP54283_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Additional InformationIHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APOE
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Concentration0.5 mg/ml
Blocking PeptideFor anti-APOE (ARP54283_P050) antibody is Catalog # AAP54283 (Previous Catalog # AAPP31032)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
SPR Affinity Characterization Avivasheild
ReferenceHo,R.C., (2008) Am J Geriatr Psychiatry 16 (6), 519-522
Publications

Evaluation of Apolipoprotein E Fragmentation as a Biomarker for Alzheimer's Disease. J Neurol Neurol Disord. 3, (2017). 29520379

Nuclear uptake of an amino-terminal fragment of apolipoprotein E4 promotes cell death and localizes within microglia of the Alzheimer's disease brain. Int J Physiol Pathophysiol Pharmacol. 9, 40-57 (2017). 28533891

Proteolytic Cleavage of Apolipoprotein E in the Down Syndrome Brain. Aging Dis. 7, 267-77 (2016). 27330841

Rohn, T. T., Catlin, L. W., Coonse, K. G. & Habig, J. W. Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimer’s disease brain. Brain Res. 1475, 106-15 (2012). 22902767

Rohn, T. T., Day, R. J., Sheffield, C. B., Rajic, A. J. & Poon, W. W. Apolipoprotein E pathology in vascular dementia. Int. J. Clin. Exp. Pathol. 7, 938-47 (2014). 24696712

Description
Gene SymbolAPOE
Gene Full NameApolipoprotein E
Alias SymbolsAD2, LPG, APO-E, ApoE4, LDLCQ5
NCBI Gene Id348
Protein NameApolipoprotein E
Description of TargetChylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP02649
Protein Accession #NP_000032
Nucleotide Accession #NM_000041
Protein Size (# AA)317
Molecular Weight36 kDa
Protein InteractionsLCAT; ARFGAP1; ALB; C19orf52; LOXL4; PRAM1; MID1IP1; ANKH; FBXL12; FXYD7; ECSIT; PDCD4; IFIT5; MAST1; EPN2; PLEKHA6; CDC37; IQSEC1; LONP1; TYRO3; PRDX2; ST13; RPL4; RHEB; PSEN1; HTRA1; PCMT1; ZNF558; NOS3; IFIT3; GCDH; FOXG1; FARSA; ELAVL1; CYP2C18; CYP2C
  1. What is the species homology for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "APOE Antibody - N-terminal region (ARP54283_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APOE Antibody - N-terminal region (ARP54283_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    This target may also be called "AD2, LPG, APO-E, ApoE4, LDLCQ5" in publications.

  5. What is the shipping cost for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "APOE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APOE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APOE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APOE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APOE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APOE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APOE Antibody - N-terminal region (ARP54283_P050)
Your Rating
We found other products you might like!