website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

APOE antibody - N-terminal region (ARP54283_P050)

Receive a free blocking peptide (AAP54283) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Apolipoprotein E
NCBI Gene Id:
Alias Symbols:
AD2; MGC1571; apoprotein; LPG; LDLCQ5
Tissue Tool:
Find tissues and cell lines supported to express APOE.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Apolipoprotein E
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-APOE antibody: synthetic peptide directed towards the N terminal of human APOE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
APOE antibody - N-terminal region (ARP54283_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-APOE antibody
- ARP54283_P050
Peptide Sequence:
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Blocking Peptide:
For anti-APOE antibody is Catalog # AAP54283 (Previous Catalog # AAPP31032)
Additional Information:
IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Ho,R.C., (2008) Am J Geriatr Psychiatry 16 (6), 519-522
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Anti-ApoE4 ARP54283_P050 has recently been referenced in the following publications:

Rohn, T. T., Catlin, L. W., Coonse, K. G. & Habig, J. W. Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimer’s disease brain. Brain Res. 1475, 106–15 (2012). 22902767

Customer Reviews for APOE Antibody (ARP54283_P050) tested with rat brain tissue in Immunohistochemistry

CAT#: ARP54283

submitted by:
Thomas Van Groen PhD
University of Alabama
Neuroscience lab
Version: 2.0
Date: 17 Oct 2005





1) Fill water bath with warm water, set it for 85oC.

2) Put square glass jar (filled with the citrate solution) on a rack in the water bath, so it gets heated to the appropriate temperature, i.e., 85oC.

3) Put a tissue rack with the to be treated tissue in the water bath for 30 minutes.

4) Take it out and let it cool down in either citrate or phosphate buffer.


1) Put plastic tray filled with some water (about 3 cm high) in microwave.

2) Put glass tray with citrate buffer, with rack (new rack) with sections in glass tray.

3) Heat for 3 min at 440 Watt setting.

4) Let it cool down (20 min) and rinse in buffer.


0.05 M NaCitrate solution; add 14.7 g of NaCitrate-2 hydrate to 1 liter of dH2O,
NOTE: adjust pH. to pH 6.0


1. Pretreat tissue in hot citrate solution (see protocol).

2. Use small (4 x 6) tray; rinse tissue 3 X 5 min each in TBS-T (Tris Buffered Saline + 0.5% Triton; pH 7.6). Approximately 20 ml/tray.

3. Put in primary antibody (mouse anti-APP at 1:5000; Chemicon) for 18 h at room temperature (20 C) in TBS-T on a shaker table in the dark.
Mouse anti-APP at 1:5000
2 ml antibody in 10 ml TBS-T

4. Rinse 3 X (5 min each) in TBS-T; approximately 20 ml.

5. Put in secondary antibody (Goat anti-mouse*biotin at 1:400; Sigma) for 2 h.
Goat anti-mouse*biotin at 1:400
25 ml antibody in 10 ml TBS-T

6. Rinse 3 X in TBS-T (5 min each); approximately 20 ml.

7. Put in ExtrAvidin® (at 1:1000) for 2 h.
ExtrAvidin® at 1:1000
10 ml antibody in 10 ml TBS-T

8. Rinse 3 X in TBS-T (5 min each); approximately 20 ml.

9. Put in metal-intensified DAB for approximately 3 min.
-20 ml 0.05 M Tris Buffer pH 7.6
-5 mg DAB
-1 ml of a saturated Ni ammonium sulfate solution
-15 ml 30 % H2O2

10. Rinse excess DAB out with Naphosphate buffer, mount tissue.

NOTE: Filter solution before use. Anything that DAB comes in contact with should be neutralized with a diluted bleach solution. DAB is a SUSPECTED CARCINOGEN; you should/can use gloves and particle mask.


To make 2 liters:
Trizma HCl 12.12 g
Trizma Base 2.78 g
NaCl 58.4 g
Triton 5 ml

Computational species homology for APOE antibody (ARP54283)

Product page for APOE antibody (ARP54283)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Bornean orangutan APOE antibody; Pongo pygmaeus APOE antibody Q9GLM7 92%
Chimpanzee APOE antibody; Pan troglodytes APOE antibody Q9GJU3 85%
Common gibbon APOE antibody; Hylobates lar APOE antibody Q9GLM6 85%
Crab-eating macaque APOE antibody; Macaca fascicularis APOE antibody P10517 78%
Human APOE antibody; Homo sapiens APOE antibody P02649 100%
Human APOE antibody; Homo sapiens APOE antibody Q6LA97 100%
Human APOE antibody; Homo sapiens APOE antibody H0Y7L5 100%
Human APOE antibody; Homo sapiens APOE antibody E9PEV4 100%
Human APOE antibody; Homo sapiens APOE antibody E7ERP7 100%
Human HMGA1 antibody; Homo sapiens HMGA1 antibody Q6ZP45 100%
Lowland gorilla APOE antibody; Gorilla gorilla gorilla APOE antibody Q9GLM8 85%
Lowland gorilla APOE antibody; Gorilla gorilla gorilla APOE antibody G3QU41 85%
Northern white-cheeked gibbon APOE antibody; Nomascus leucogenys APOE antibody G1QMD1 85%
Rhesus macaque Mmu.3035 antibody; Macaca mulatta Mmu.3035 antibody F7BSJ1 78%

Product Review: APOE antibody - N-terminal region (ARP54283_P050) using Human brain cell homogenates in Western Blot

Product Page Link: APOE antibody - N-terminal region (ARP54283_P050)

Data provided by Dr. Martin Sadowski of the New York University School of Medicine

"We have done a couple of WB using your polyclonal antibody sample. It detects recombinant human APO E3 and E4 with great sensitivity and they are amazingly clean (i.e. do not produce non-specific staining on WB of brain and cell homogenates).

Sample type: Human brain cell homogenates

Primary Antibody Dilution: 1:000

Secondary Antibody Dilution: 1:2000

Ask a Question