website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

APOE antibody - N-terminal region (ARP54283_P050)

Receive a free blocking peptide (AAP54283) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.

Anti-ApoE4 ARP54283_P050 has recently been referenced in the following publications:

Rohn, T. T., Catlin, L. W., Coonse, K. G. & Habig, J. W. Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimer’s disease brain. Brain Res. 1475, 106–15 (2012). , 22902767

Description of Target:
Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Apolipoprotein E
NCBI Gene Id:
Alias Symbols:
AD2; MGC1571; apoprotein; LPG; LDLCQ5
Tissue Tool:
Find tissues and cell lines supported to express APOE.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Apolipoprotein E
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-APOE antibody: synthetic peptide directed towards the N terminal of human APOE
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
APOE antibody - N-terminal region (ARP54283_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-APOE antibody
- ARP54283_P050
Peptide Sequence:
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Blocking Peptide:
For anti-APOE antibody is Catalog # AAP54283 (Previous Catalog # AAPP31032)
Additional Information:
IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Key Reference:
Ho,R.C., (2008) Am J Geriatr Psychiatry 16 (6), 519-522
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-APOE antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question