SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40252_P050
Price: $0.00
SKU
ARP40252_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-APOBEC3F (ARP40252_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3F
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD
Concentration0.5 mg/ml
Blocking PeptideFor anti-APOBEC3F (ARP40252_P050) antibody is Catalog # AAP40252 (Previous Catalog # AAPS00601)
Sample Type Confirmation

APOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3

ReferenceNaito,E., (2008) J. Virol. 82 (11), 5636-5642
Gene SymbolAPOBEC3F
Gene Full NameApolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
Alias SymbolsA3F, KA6, ARP8, BK150C2.4.MRNA
NCBI Gene Id200316
Protein NameDNA dC->dU-editing enzyme APOBEC-3F
Description of TargetAPOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDQ8IUX4
Protein Accession #NP_660341
Nucleotide Accession #NM_145298
Protein Size (# AA)373
Molecular Weight45kDa
Protein Interactionsvif; BMI1; ACD; TINF2; UBC;
  1. What is the species homology for "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APOBEC3F Antibody - N-terminal region (ARP40252_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    This target may also be called "A3F, KA6, ARP8, BK150C2.4.MRNA" in publications.

  5. What is the shipping cost for "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APOBEC3F Antibody - N-terminal region (ARP40252_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "APOBEC3F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APOBEC3F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APOBEC3F"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APOBEC3F"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APOBEC3F"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APOBEC3F"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APOBEC3F Antibody - N-terminal region (ARP40252_P050)
Your Rating
We found other products you might like!