APOA4 Antibody - C-terminal region (ARP54316_P050)

Catalog No: ARP54316_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-APOA4 Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APOA4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-APOA4 (ARP54316_P050) antibody is Catalog # AAP54316 (Previous Catalog # AAPP31065)
• Reference: Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press

Target Info

• Gene Symbol: APOA4
• Gene Full Name: Apolipoprotein A-IV
• Alias Symbols: MGC142154, MGC142156
• NCBI Gene Id: 337
• Protein Name: Apolipoprotein A-IV
• Description of Target: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P06727
• Protein Accession #: NP_000473
• Nucleotide Accession #: NM_000482
• Protein Size (# AA): 396
• Molecular Weight: 45 kDa
• Protein Interactions: ALB; GPLD1; APOA4;