website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

APEX1 antibody - N-terminal region (ARP32651_T100)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells.
Gene Symbol:
APEX1
Official Gene Full Name:
APEX nuclease (multifunctional DNA repair enzyme) 1
NCBI Gene Id:
328
Alias Symbols:
APE; APX; APE1; APEN; APEX; HAP1; REF1
Sample Type Confirmation:

APEX1 is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express APEX1.
Protein Accession #:
NP_542379
Nucleotide Accession#:
NM_080648
Swissprot Id:
P27695
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
DNA-(apurinic or apyrimidinic site) lyase
Protein Size (# AA):
318
Molecular Weight:
35kDa
Application:
IHC, WB
Partner Proteins:
DUSP26, HSF4, MAPK1, MAPK14, MAPK3, MAPK8, SLC27A5
Immunogen:
The immunogen for anti-APEX1 antibody: synthetic peptide directed towards the N terminal of human APEX1
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
APEX1 antibody - N-terminal region (ARP32651_T100)
Predicted Homology Based on Immunogen Sequence:
Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Pig: 85%; Guinea pig: 85%; Goat: 83%
Species Reactivity:
Horse, Human, Mouse, Rabbit, Rat, Dog, Bovine, Pig, Guinea pig, Goat
Datasheets / Downloads:
Printable datasheet for
anti-APEX1 antibody
- ARP32651_T100
Peptide Sequence:
Synthetic peptide located within the following region: KGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGY
Blocking Peptide:
For anti-APEX1 antibody is Catalog # AAP32651 (Previous Catalog # AAPP03661)
Target Reference:
Ding,S.Z., et al., (2004) Gastroenterology 127 (3), 845-858
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-APEX1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for APEX1 antibody (ARP32651)

Product page for APEX1 antibody (ARP32651)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100661299 antibody; Loxodonta africana LOC100661299 antibody G3TQD8 92%
Bornean orangutan APEX1 antibody; Pongo pygmaeus APEX1 antibody A2T7I6 100%
Bovine APEX1 antibody; Bos taurus APEX1 antibody P23196 91%
Chimpanzee APEX1 antibody; Pan troglodytes APEX1 antibody A2T6Y4 100%
Chinese hamster Apex1 antibody; Cricetulus griseus Apex1 antibody Q9Z2J2 84%
Dog APEX1 antibody; Canis familiaris APEX1 antibody E2RH06 92%
Dog APEX1 antibody; Canis familiaris APEX1 antibody F1PFY2 84%
Giant panda LOC100482041 antibody; Ailuropoda melanoleuca LOC100482041 antibody D2I2U8 92%
Goat APEX1 antibody; Capra hircus APEX1 antibody G1DFN8 83%
Guinea pig LOC100719062 antibody; Cavia porcellus LOC100719062 antibody H0VR33 84%
Horse LOC100072588 antibody; Equus caballus LOC100072588 antibody F6ZB53 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody P27695 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody Q5TZP7 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody G3V5Q1 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody G3V5M0 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody G3V3M6 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody G3V3C7 100%
Human APEX1 antibody; Homo sapiens APEX1 antibody G3V359 100%
Little brown bat APEX1 antibody; Myotis lucifugus APEX1 antibody G1QBU1 100%
Lowland gorilla APEX1 antibody; Gorilla gorilla gorilla APEX1 antibody A1YES6 92%
Lowland gorilla APEX1 antibody; Gorilla gorilla gorilla APEX1 antibody G3QI91 92%
Mouse APEX1 antibody; Mus musculus APEX1 antibody P28352 92%
Mouse Apex1 antibody; Mus musculus Apex1 antibody Q544Z7 92%
Mouse Apex1 antibody; Mus musculus Apex1 antibody F6QA74 92%
Mouse Apex1 antibody; Mus musculus Apex1 antibody D3Z124 92%
Northern white-cheeked gibbon LOC100592412 antibody; Nomascus leucogenys LOC100592412 antibody G1RJ52 100%
Pig APEX1 antibody; Sus scrofa APEX1 antibody F1S8H5 84%
Pig APEX1 antibody; Sus scrofa APEX1 antibody B6VAP9 84%
Pygmy chimpanzee APEX1 antibody; Pan paniscus APEX1 antibody A1YFZ3 100%
Rabbit LOC100348924 antibody; Oryctolagus cuniculus LOC100348924 antibody G1SN16 92%
Rat APEX1 antibody; Rattus norvegicus APEX1 antibody P43138 92%
Rat Apex1 antibody; Rattus norvegicus Apex1 antibody Q99PF3 92%
Rhesus macaque APEX1 antibody; Macaca mulatta APEX1 antibody F7GIK6 100%
Ring-tailed lemur APEX1 antibody; Lemur catta APEX1 antibody A2D5X9 91%
White-tufted-ear marmoset LOC100400557 antibody; Callithrix jacchus LOC100400557 antibody F7HKI5 92%

Product Protocols: APEX1 antibody tested with Human Hepg2 Cells (ARP32651_T100)

Aviva Systems Biology is the original manufacturer of this APEX1 antibody (ARP32651_T100)

Click here to view the APEX1 antibody Western Blot Protocol

Product Datasheet Link: APEX1 antibody (ARP32651_T100)

WB Suggested Anti-APEX1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s APEX1 antibody (ARP32651_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: APEX1 antibody tested by IHC with human lung (ARP32651)

Aviva Systems Biology is the original manufacturer of this APEX1 antibody.

Click here to view the APEX1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: APEX1 antibody (ARP32651)

IHC Information:

Rabbit Anti-APEX1 Antibody
Catalog Number: ARP32651
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question