Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP36582_T100
Price: $0.00
SKU
ARP36582_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Anxa6 (ARP36582_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human Anxa6
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 79%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK
Concentration1.0 mg/ml
Blocking PeptideFor anti-Anxa6 (ARP36582_T100) antibody is Catalog # AAP36582 (Previous Catalog # AAPP07815)
Sample Type Confirmation

Anxa6 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceCuschieri,J., et al., (2005) Surgery 138 (2), 158-164
Gene SymbolAnxa6
Gene Full NameAnnexin A6
Alias Symbolsp68, p70, ANX6, CBP68, CPB-II
NCBI Gene Id309
Protein NameAnnexin A6
Description of TargetAnnexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Uniprot IDP08133
Protein Accession #NP_001146
Nucleotide Accession #NM_001155
Protein Size (# AA)673
Molecular Weight74kDa
Protein InteractionsUBC; MDM2; THOP1; PLS3; MTAP; IDH1; HPRT1; GOT1; ADSS; POLE3; NAMPT; UBE2H; ATP4A; METTL18; MLH1; SNCA; CUL5; SIRT7; PRKCA; TJP1; CD4; H2AFX; CDC73; TPD52; S100B; S100A1; RASA1; CR2; A2M; tax;
  1. What is the species homology for "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Guinea Pig, Rabbit".

  2. How long will it take to receive "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Anxa6 Antibody - C-terminal region (ARP36582_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    This target may also be called "p68, p70, ANX6, CBP68, CPB-II" in publications.

  5. What is the shipping cost for "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Anxa6 Antibody - C-terminal region (ARP36582_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANXA6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Anxa6 Antibody - C-terminal region (ARP36582_T100)
Your Rating
We found other products you might like!