SOX10 antibody - middle region (ARP33326_P050)

Catalog#: ARP33326_P050

• Size: 50ug

Human HepG2

Human HEK293

Human Skin

Human Kidney

Human Kidney

• Description of Target: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Gene Symbol: SOX10
• Official Gene Full Name: SRY (sex determining region Y)-box 10
• Alias Symbols: DOM; MGC15649; WS2E; WS4; PCWH; WS4C
• Protein Accession#: NP_008872
• Nucleotide Accession#: NM_006941
• Swissprot Id: P56693
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 466
• Molecular Weight: 50kDa
• Application: WB, IHC
• Partner Proteins: PAX3, POU3F2, SOX10, ALX4, CEBPA, DLX5, EGR2, HHEX, HIVEP1, HOXA3, HOXC4, JUN, MEOX1, NMI, OLIG2, PAX3, PAX6, POU3F2, POU3F3, POU5F1, PRRX1, PRRX2, SOX10, SP1, SUMO1, SUMO2, SUMO3, TCF12, UBE2I, UTF1, PAX3
• Immunogen: The immunogen for anti-SOX10 antibody: synthetic peptide directed towards the middle region of human SOX10
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Bovine: 92%; Dog: 92%; Guinea pig: 92%; Horse: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
• Blocking Peptide: For anti-SOX10 antibody is Catalog # AAP33326
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-SOX10 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Customer Reviews for SOX10 Antibody (ARP33326_P050) tested with human skin in Immunohistochemistry

CAT# ARP33326

submitted by:
Sergey Ivanov
Vanderbilt University

What type of experimental sample are you using and how did you prepare it?

We are using HEK293 whole cell lysates with Aviva protocol.

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

The primary antibodies were tested in Western blot experiments at 1:4,000, secondary antibody was used at 1:10,000 dilution.

What controls were used in your experiment? Please include your positive control.

p53 is used as a positive control; protein transfer was monitored via Ponceau staining.

How did you store the antibody after re-suspension?

Frozen at -20 C in aliquots.

Please provide the protocol for your application procedure. Please be as detailed as possible.

Experiment done using the Aviva protocol. All antibodies show virtually no background.

How would you rate this antibody on a scale from 1-5? Why?

excellent (5, produced unique bands with expected sizes)

Would you use this antibody in future experiments?

yes

Product Protocols: SOX10 antibody tested with Human Hepg2 Cells (ARP33326_P050)

Aviva Systems Biology is the original manufacturer of this SOX10 antibody (ARP33326_P050)

Click here to view the SOX10 antibody Western Blot Protocol

Product Datasheet Link: SOX10 antibody (ARP33326_P050)

WB Suggested Anti-SOX10 Antibody Titration: .25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SOX10 antibody (ARP33326_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: SOX10 antibody tested by IHC with human skin (ARP33326)

Aviva Systems Biology is the original manufacturer of this SOX10 antibody.

Click here to view the SOX10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SOX10 antibody (ARP33326)

IHC Information:

Rabbit Anti-SOX10 Antibody
Catalog Number: ARP33326
Paraffin Embedded Tissue: Human Skin
Cellular Data: Epidermal cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: SOX10 antibody tested by IHC with human kidney (ARP33326)

Aviva Systems Biology is the original manufacturer of this SOX10 antibody.

Click here to view the SOX10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SOX10 antibody (ARP33326)

IHC Information:

Rabbit Anti-SOX10 Antibody
Catalog Number: ARP33326
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Review: SOX10 antibody – middle region (ARP33326_P050) in human optic nerves and spinal cord using Immunohistochemistry

Product Page Link: SOX10 antibody - middle region (ARP33326_P050)

Alison Jennings
UWA
School of Pathology and Laboratory Medicine M504

• Lyophilized antibody samples reconstituted in 10µl distilled water
• Antibody dilutions made up in PBS
• Microwave Antigen retrieval of sections carried out in 0.5% citraconic anhydride (Sigma) pH7.4 for 25 minutes at 92 C followed by cooling to ambient temperature (approx. 20 minutes)
• Blocking step 10% normal horse serum in PBS
• Primary antibody incubation for 2 hours at 37C then overnight at 4C
• Blocking of non specific peroxidase with 3% hydrogen peroxide for 5 minutes
• Secondary link antibody either PolyEnvision (pEV; Dako) or Novolink (NL; Novocastra)
• Chromogen DAB (Vector ImmPACT)

Tissue sections

A/ [IHC-PZ] (optimal processing)
human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns

A2/ [IHC-PZ + FF]
As above for initial fixation then post-fixed in 10% buffered formalin for 5 days

B/ [IHC-P]
human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns

Controls
Negative: omission of primary.
Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P)