SMC3 antibody - C-terminal region (ARP47590_P050)

Catalog#: ARP47590_P050

• Size: 50ug

Human HepG2

Human Testis

• Description of Target: SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.
• Gene Symbol: SMC3
• Official Gene Full Name: Structural maintenance of chromosomes 3
• Alias Symbols: BAM; BMH; CDLS3; CSPG6; HCAP; SMC3L1
• Protein Accession#: AAD32447
• Nucleotide Accession#: NM_005445
• Swissprot Id: Q9UQE7
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 681
• Molecular Weight: 74kDa
• Application: WB, IHC
• Partner Proteins: DNAJC5, SNAP23, AGFG1, AP3D1, DNAJC5, SNAP23, SNAP25, SNAP29, STX1A, STX3, STX4, STX7, AP3D1, AP3M1, SNAP23, SNAP25, SNAP29, STX1A, STX4
• Immunogen: The immunogen for anti-SMC3 antibody: synthetic peptide directed towards the C terminal of human SMC3
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV
• Blocking Peptide: For anti-SMC3 antibody is Catalog # AAP47590 (Previous Catalog # AAPP13005)
• Additional Information: IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-SMC3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SMC3 antibody tested with Human Hepg2 Cells (ARP47590_P050)

Aviva Systems Biology is the original manufacturer of this SMC3 antibody (ARP47590_P050)

Click here to view the SMC3 antibody Western Blot Protocol

Product Datasheet Link: SMC3 antibody (ARP47590_P050)

WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SMC3 antibody (ARP47590_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com