PNKP antibody - N-terminal region (ARP52311_P050)

Catalog#: ARP52311_P050

• Size: 50ug

Transfected 293T

• Description of Target: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.
• Gene Symbol: PNKP
• Official Gene Full Name: Polynucleotide kinase 3'-phosphatase
• Alias Symbols: PNK; MCSZ; EIEE10
• Protein Accession#: NP_009185
• Nucleotide Accession#: NM_007254
• Swissprot Id: Q96T60
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 521
• Molecular Weight: 57kDa
• Application: WB
• Partner Proteins: XRCC1, KRTAP4-12, MAGEA11, MYOZ1, SMAD5, TRIM37, XRCC1, XRCC4, ATAD3B, DDX20, HEATR2, KRTAP4-12, LAS1L, LIG3, LIG4, MAGEA11, MCM3, MYOZ1, NOL3, NOM1, NUP93, POLB, SLC25A12, TRIM37, XRCC1, XRCC4, YWHAQ
• Immunogen: The immunogen for anti-PNKP antibody: synthetic peptide directed towards the N terminal of human PNKP
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ
• Blocking Peptide: For anti-PNKP antibody is Catalog # AAP52311 (Previous Catalog # AAPP42915)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-PNKP antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.