PCK1 antibody - middle region (ARP32801_T100)

Catalog#: ARP32801_T100

• Size: 100ug

Human Fetal Brain

Human MCF7

Hum. Fetal Heart

Hum. Fetal Lung

Hum. Fetal Liver

• Description of Target: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.
• Gene Symbol: PCK1
• Official Gene Full Name: Phosphoenolpyruvate carboxykinase 1 (soluble)
• Alias Symbols: PEPCK1; PEPCKC; PEPCK-C
• Protein Accession#: NP_002582
• Nucleotide Accession#: NM_002591
• Swissprot Id: P35558
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 622
• Molecular Weight: 69kDa
• Application: WB, IHC
• Immunogen: The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; African clawed frog: 85%
• Peptide Sequence: Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
• Blocking Peptide: For anti-PCK1 antibody is Catalog # AAP32801
• Key Reference: Hajarnis,S., et al., (2005) J Biol Chem. 280(31), 28272-80
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-PCK1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: PCK1 antibody tested by IHC with human kidney (ARP32801)

Aviva Systems Biology is the original manufacturer of this PCK1 antibody.

Click here to view the PCK1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: PCK1 antibody (ARP32801)

IHC Information:

Rabbit Anti-PCK1 Antibody
Catalog Number: ARP32801
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: