- Description of Target:
- NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.
- Gene Symbol:
- NMUR2
- Official Gene Full Name:
- Neuromedin U receptor 2
- Alias Symbols:
- FM4; FM-4; TGR1; NMU2R; TGR-1; NMU-R2
- Tissue Tool:
- Find tissues and cell lines supported to express NMUR2.
- Protein Accession# :
- NP_064552
- Nucleotide Accession#:
- NM_020167
- Swissprot Id:
- Q9GZQ4
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 415
- Molecular Weight:
- 46kDa
- Application:
- WB
- Partner Proteins:
- SLC35E1, TRIM27, SLC35E1, TRIM27
- Immunogen:
- The immunogen for anti-NMUR2 antibody: synthetic peptide directed towards the N terminal of human NMUR2
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- NMUR2 antibody - N-terminal region (ARP35300_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-NMUR2 antibody
- ARP35300_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV
- Blocking Peptide:
- For anti-NMUR2 antibody is Catalog # AAP35300
- Key Reference:
- Fernandez (2002) Peptides 23 (9), 1617-1623
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-NMUR2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
