NAB2 antibody - C-terminal region (ARP38716_P050)

Catalog#: ARP38716_P050

• Size: 50ug

Human Heart

• Description of Target: NAB2 is a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize withThis gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: NAB2
• Official Gene Full Name: NGFI-A binding protein 2 (EGR1 binding protein 2)
• Alias Symbols: MADER; MGC75085
• Protein Accession#: NP_005958
• Nucleotide Accession#: NM_005967
• Swissprot Id: Q15742
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 525
• Molecular Weight: 56kDa
• Application: WB
• Partner Proteins: AES, TLE1, AES, CCDC85B, DACH1, EYA1, EYA2, EYA3, EYA4, MDFI, SIX1, TLE1, CCDC85B, EYA1, EYA2, MDFI
• Immunogen: The immunogen for anti-NAB2 antibody: synthetic peptide directed towards the C terminal of human NAB2
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%
• Peptide Sequence: Synthetic peptide located within the following region: GRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
• Blocking Peptide: For anti-NAB2 antibody is Catalog # AAP38716 (Previous Catalog # AAPP20923)
• Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-NAB2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: NAB2 antibody tested with Human Fetal Heart Tissue (ARP38716_P050)

Aviva Systems Biology is the original manufacturer of this NAB2 antibody (ARP38716_P050)

Click here to view the NAB2 antibody Western Blot Protocol

Product Datasheet Link: NAB2 antibody (ARP38716_P050)

WB Suggested Anti-NAB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Heart

Western Blot image:


Description of Target: NAB2 is a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize withThis gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s NAB2 antibody (ARP38716_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com