- Description of Target:
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
- Gene Symbol:
- MRPS15
- Official Gene Full Name:
- Mitochondrial ribosomal protein S15
- Alias Symbols:
- DC37; FLJ11564; MPR-S15; RPMS15; S15mt
- Tissue Tool:
- Find tissues and cell lines supported to express MRPS15.
- Protein Accession# :
- NP_112570
- Nucleotide Accession#:
- NM_031280
- Swissprot Id:
- P82914
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 257
- Molecular Weight:
- 30kDa
- Application:
- WB, IHC
- Immunogen:
- The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the N terminal of human MRPS15
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- MRPS15 antibody - N-terminal region (ARP33299_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Guinea pig: 100%; Human: 100%; Dog: 92%; Rabbit: 85%; Mouse: 83%
- Datasheets / Downloads:
- Printable datasheet for
anti-MRPS15 antibody
- ARP33299_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK
- Blocking Peptide:
- For anti-MRPS15 antibody is Catalog # AAP33299 (Previous Catalog # AAPP04341)
- Key Reference:
- Zhang,Z. (2003) Genomics 81 (5), 468-480
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-MRPS15 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: MRPS15 antibody tested with Human 721_B_Lymphoblast (ARP33299_P050)
Aviva Systems Biology is the original manufacturer of this MRPS15 antibody (ARP33299_P050)
Click here to view the MRPS15 antibody Western Blot Protocol
Product Datasheet Link: MRPS15 antibody (ARP33299_P050)
WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B_lymphoblast
Western Blot image: 
Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s MRPS15 antibody (ARP33299_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: MRPS15 antibody tested by IHC with human lung (ARP33299)
Aviva Systems Biology is the original manufacturer of this MRPS15 antibody.
Click here to view the MRPS15 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: MRPS15 antibody (ARP33299)
IHC Information:
Rabbit Anti-MRPS15 Antibody
Catalog Number: ARP33299
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
