- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- Irx2
- Official Gene Full Name:
- Iroquois related homeobox 2 (Drosophila)
- Alias Symbols:
- IRX6; MGC103290
- Tissue Tool:
- Find tissues and cell lines supported to express Irx2.

- Protein Accession# :
- NP_034704
- Nucleotide Accession#:
- NM_010574
- Swissprot Id:
- P81066
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 474
- Molecular Weight:
- 49kDa
- Application:
- WB
- Partner Proteins:
- Mapk1
- Immunogen:
- The immunogen for anti-Irx2 antibody: synthetic peptide directed towards the middle region of mouse Irx2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- Irx2 antibody - middle region (ARP37073_P050)
- Predicted Homology Based on Immunogen Sequence:
- Mouse: 100%; Rat: 100%; Dog: 84%; Human: 84%; Rabbit: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-Irx2 antibody
- ARP37073_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: RRLKKENKMTWAPRNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEG
- Blocking Peptide:
- For anti-Irx2 antibody is Catalog # AAP37073 (Previous Catalog # AAPP09305)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Irx2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: Irx2 antibody tested with Human Mouse Heart Tissue (ARP37073_P050)
Aviva Systems Biology is the original manufacturer of this Irx2 antibody (ARP37073_P050)
Click here to view the Irx2 antibody Western Blot Protocol
Product Datasheet Link: Irx2 antibody (ARP37073_P050)
WB Suggested Anti-Irx2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Mouse Heart
Western Blot image: 
Description of Target: The function of this protein remains unknown.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s Irx2 antibody (ARP37073_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


