GJB2 antibody - N-terminal region (ARP36608_T100)

Catalog#: ARP36608_T100

• Size: 100ug

Human Lung

• Description of Target: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
• Gene Symbol: GJB2
• Official Gene Full Name: Gap junction protein, beta 2, 26kDa
• Alias Symbols: HID; KID; PPK; CX26; DFNA3; DFNB1; NSRD1; DFNA3A; DFNB1A
• Protein Accession#: NP_003995
• Nucleotide Accession#: NM_004004
• Swissprot Id: P29033
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 226
• Molecular Weight: 25kDa
• Application: WB
• Partner Proteins: C20orf4, GJA1, PRKACA, C20orf4, GJA1
• Immunogen: The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%; Bovine: 85%; Guinea pig: 85%; Mouse: 85%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
• Blocking Peptide: For anti-GJB2 antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847)
• Key Reference: Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-GJB2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: GJB2 antibody tested with Human Fetal Lung Tissue (ARP36608_T100)

Aviva Systems Biology is the original manufacturer of this GJB2 antibody (ARP36608_T100)

Click here to view the GJB2 antibody Western Blot Protocol

Product Datasheet Link: GJB2 antibody (ARP36608_T100)

WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal lung

Western Blot image:


Description of Target: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GJB2 antibody (ARP36608_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com