- Description of Target:
- ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma.
- Gene Symbol:
- ETS2
- Official Gene Full Name:
- V-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
- Alias Symbols:
- ETS2IT1
- Tissue Tool:
- Find tissues and cell lines supported to express ETS2.
- Protein Accession# :
- NP_001120734
- Nucleotide Accession#:
- NM_001127262
- Swissprot Id:
- O88898-4
- Host:
- Rabbit
- Protein Size (# AA):
- 469
- Molecular Weight:
- 53kDa
- Application:
- WB
- Partner Proteins:
- BRCA1,NCOA3,NCOR1,SMARCA4,SRC,TDP2,CDK10,CREBBP,EP300,ERG,ETS1,ETS2,GATA3,JUN,NCOR1,NR3C1,POU5F1,SMARCA4,SRC,STAT5B,TDP2,ZFYVE9,ZMYND11,CDK10,CREBBP,EP300,ERG,ETS1,FOS,JUN,NCOA3,NCOR1,NR3C1,SPI1,SRC,ZMYND11
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- ETS2 antibody - middle region (ARP31071_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%; Rabbit: 91%
- Datasheets / Downloads:
- Printable datasheet for
anti-ETS2 antibody
- ARP31071_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
- Blocking Peptide:
- For anti-ETS2 antibody is Catalog # AAP31071
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-ETS2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
