Dpy19l1 antibody - C-terminal region (ARP43555_P050)

Description of Target:: The function remains unknown.
Gene Symbol:: Dpy19l1
Official Gene Full Name:: Dpy-19-like 1 (C. elegans)
Alias Symbols:: 1100001I19Rik; 6030402K12; AI225861; AW558481
Tissue Tool:: Find tissues and cell lines supported to express Dpy19l1.
Protein Accession# :: NP_766508
Nucleotide Accession#:: NM_172920
Swissprot Id:: A6X919
Host:: Rabbit
Clonality:: Polyclonal
Protein Size (# AA):: 552
Molecular Weight:: 62kDa
Application:: WB
Immunogen:: The immunogen for anti-Dpy19l1 antibody: synthetic peptide corresponding to a region of Mouse
Product Format:: Lyophilized powder

Complete computational species homology data:: Dpy19l1 antibody - C-terminal region (ARP43555_P050)
Predicted Homology Based on Immunogen Sequence:: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Datasheets / Downloads:: Printable datasheet for
anti-Dpy19l1 antibody
- ARP43555_P050
Peptide Sequence:: Synthetic peptide located within the following region: VKLSALRPVVNHPHYEDAGLRARTKIVYSMYSRKAPEDVKKELMKLKVNY
Blocking Peptide:: For anti-Dpy19l1 antibody is Catalog # AAP43555 (Previous Catalog # AAPP11547)
Key Reference:: N/A
Reconstitution and Storage:: Add 50 μl of distilled water. Final anti-Dpy19l1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.