COPS5 antibody - N-terminal region (ARP31512_P050)

Catalog#: ARP31512_P050

• Size: 50ug

Human Muscle

Mouse B8, Human HEK293

• Description of Target: COPS5 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: COPS5
• Official Gene Full Name: COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)
• Alias Symbols: CSN5; JAB1; MGC3149; MOV-34; SGN5
• Protein Accession#: NP_006828
• Nucleotide Accession#: NM_006837
• Swissprot Id: Q92905
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 334
• Molecular Weight: 37kDa
• Application: WB
• Subunit: 5
• Partner Proteins: RIPK1, TICAM1, TNFRSF1A, TRAF2, RIPK1, TICAM1, TNFRSF1A, TRAF2
• Immunogen: The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%
• Peptide Sequence: Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY
• Blocking Peptide: For anti-COPS5 antibody is Catalog # AAP31512 (Previous Catalog # AAPP02274)
• Key Reference: Zhang,X.C., (2008) J. Cell. Biochem. 103 (4), 1219-1230
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-COPS5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Customer Reviews for COPS5 Antibody (ARP31512_P050) tested with human blood and HEK293 lysates in Western blot

CAT# ARP31512_P050 COPS5

COPS5 Antibody

COPS5 Western Blot

COPS5 Mouse B8 cells, S-pombe, human blood, HEK293 cells

Submitted By: Dr. Elah Pick and Dr. Amnon Golan, University of Haifa, at Oranim

• Rating 4/5.
• Valid for not more than 5 uses.

Cell types are:
1) B8 mouse fibroblast stably cells expressing Flag Csn2 (“mB8”).
2) HEK293 stably cells expressing Flag Csn2.
a. “Crude” - extraction only.
b. “Pure” - Partially purification by anti Flag column.
3) CSN complex purified from Human erythrocytes blood cells (“hBlood”):
a. Partially purification (DEAE column follow by Ammonium Sulfate, Glycerol gradient then MonoQ).
b. Homogeneous Purification (as “2a” and final by ResourceQ column).
4) CSN complex purified from S-Pombe cells expressing TAP-Tag peptide:
a. Partially purification (DEAE column follow by Ammonium Sulfate then anti IgG column ).
b. Purified CSN complex (DEAE column follow by Ammonium Sulfate, anti IgG column, Calmodulin column then Sucrose gradient).

Samples preparation:

Cells cultures:
All cell cultures (B8 mouse cells and HEK293 human cells) were extracted in RIPA buffer (extraction conditions: 10E7 cells per 120ul of buffer). HEK 293 cells expressing Flag Csn2, have been used either as a crude extract or as an one step Flag-purified CSN comlpex, according to Pick E. et al. 2008 MCB.

CSN preparation from Human Red Blood Cells:
CSN complex have been purified from human blood cells according to Hetfeld BK et al. 2005 Methods Enzymol. Red Cells had precipitated from 0.5 liter blood. Partially purified complex samples had taken from 1.5 ml Mono Q (AEX) peak fractions, the purified samples had taken from 1ml Resource Q (AEX) peak fractions.

Purificatrion of CSN from S-Pombe:
CSN complex have been purified from S-Pombe cells as describe above (The complex purified by unpublished protocol) from 159 gr dry cells. “Crude” samples had taken from 1 ml of IgG column peak fractions and the “Pure” samples had taken from 1ml of Sucrose Gradient column peak fraction. None of the antibody happened to recognize S. Pombe ortholog CSN subunits.

SDS – Page and immune bloting:
Running: 40mA for each gel; Transfer: 200 mA (2 gels) for 1h 30’. Blocking: Long life milk 3% fat 1:10. Antibodies in TBST with 0.02% Sodium Azid.

Product Protocols: COPS5 antibody tested with Human Fetal Muscle Tissue (ARP31512_P050)

Aviva Systems Biology is the original manufacturer of this COPS5 antibody (ARP31512_P050)

Click here to view the COPS5 antibody Western Blot Protocol

Product Datasheet Link: COPS5 antibody (ARP31512_P050)

WB Suggested Anti-COPS5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Fetal Muscle

Western Blot image:


Description of Target: COPS5 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s COPS5 antibody (ARP31512_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com