- Description of Target:
- Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
- Gene Symbol:
- ACAT2
- Official Gene Full Name:
- Acetyl-CoA acetyltransferase 2
- Protein Accession# :
- NP_005882
- Nucleotide Accession#:
- NM_005891
- Swissprot Id:
- Q16146
- Protein Size:
- 397
- Molecular Weight:
- 44kDa
- Species Reactivity:
- Human, Mouse, Rat, Bovine
- Application:
- WB, IHC
- Clonality:
- Polyclonal
- Immunogen:
- The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2
- Host:
- Rabbit
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Immunoblot Image 1 Data:
- WB Suggested Anti-ACAT2 Antibody Titration: 2.0ug/ml
Positive Control: K562 - Computational Homology Based on Immunogen Sequence:
- Human:100%; Sumatran orangutan:100%; Short-tailed gray opossum:83%; Rat:78%; Bovine:78%; Mouse:78%;
- Datasheets / Downloads:
- Printable datasheet for
anti-ACAT2 antibody
- ARP32791_T100 - Peptide Sequence:
- VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS
- Blocking Peptide:
- For anti-ACAT2 antibody is Catalog # AAP32791 (Previous Catalog # AAPP03810)
- Key Reference:
- Sakashita,N.,et al., (2003) Lab.Invest.83(11),1569-1581
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-ACAT2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Immunoblot:
- Immunohistochemistry:
Computational species homology for ACAT2 antibody (ARP32791)
Product page for ACAT2 antibody (ARP32791)
The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.
| Predicted Species & Target | Target Reference | Predicted Homology |
|---|---|---|
| African elephant ACAT2 antibody; Loxodonta africana ACAT2 antibody | G3T0U8 | 85% |
| Bovine ACAT2 antibody; Bos taurus ACAT2 antibody | Q1JPB6 | 78% |
| Bovine ACAT2 antibody; Bos taurus ACAT2 antibody | Q17QI3 | 78% |
| Dog ACAT2 antibody; Canis familiaris ACAT2 antibody | F1Q466 | 85% |
| Gray short-tailed opossum ACAT2 antibody; Monodelphis domestica ACAT2 antibody | Q9XT07 | 83% |
| Gray short-tailed opossum ACAT2 antibody; Monodelphis domestica ACAT2 antibody | F6RDB9 | 83% |
| Guinea pig ACAT2 antibody; Cavia porcellus ACAT2 antibody | H0UWR3 | 78% |
| Horse LOC100058892 antibody; Equus caballus LOC100058892 antibody | F7C5T6 | 85% |
| Human ACAT2 antibody; Homo sapiens ACAT2 antibody | B7Z233 | 100% |
| Human ACAT2 antibody; Homo sapiens ACAT2 antibody | Q59GW6 | 92% |
| Human THIC antibody; Homo sapiens THIC antibody | Q9BWD1 | 100% |
| Little brown bat ACAT2 antibody; Myotis lucifugus ACAT2 antibody | G1NTY7 | 100% |
| Lowland gorilla ACAT2 antibody; Gorilla gorilla gorilla ACAT2 antibody | G3RDU7 | 100% |
| Mouse Acat2 antibody; Mus musculus Acat2 antibody | G3XA25 | 78% |
| Mouse Acat3 antibody; Mus musculus Acat3 antibody | Q80X81 | 78% |
| Mouse Acat3 antibody; Mus musculus Acat3 antibody | F2Z459 | 78% |
| Mouse THIC antibody; Mus musculus THIC antibody | Q8CAY6 | 78% |
| Northern white-cheeked gibbon ACAT2 antibody; Nomascus leucogenys ACAT2 antibody | G1RK11 | 100% |
| Northern white-cheeked gibbon ACAT2 antibody; Nomascus leucogenys ACAT2 antibody | G1RK09 | 100% |
| Pig ACAT2 antibody; Sus scrofa ACAT2 antibody | F1SB62 | 78% |
| Rat Acat3 antibody; Rattus norvegicus Acat3 antibody | Q7TP61 | 78% |
| Rat Acat3 antibody; Rattus norvegicus Acat3 antibody | F1LS48 | 78% |
| Rat RGD1562948 antibody; Rattus norvegicus RGD1562948 antibody | D3ZKB6 | 78% |
| Rat THIC antibody; Rattus norvegicus THIC antibody | Q5XI22 | 78% |
| Rhesus macaque Mmu.4388 antibody; Macaca mulatta Mmu.4388 antibody | F6TB05 | 92% |
| Small-eared galago ACAT2 antibody; Otolemur garnettii ACAT2 antibody | H0WW28 | 92% |
| Sumatran orangutan ACAT2 antibody; Pongo abelii ACAT2 antibody | Q5RBQ6 | 100% |
| Tasmanian devil ACAT2 antibody; Sarcophilus harrisii ACAT2 antibody | G3VFY5 | 83% |
| White-tufted-ear marmoset ACAT2 antibody; Callithrix jacchus ACAT2 antibody | F7H488 | 92% |
| White-tufted-ear marmoset ACAT2 antibody; Callithrix jacchus ACAT2 antibody | F6RL30 | 92% |
- Protocol:
- Tips Information:
See our General FAQ page.
Research Areas