ANPEP Antibody - N-terminal region (ARP61079_P050)

Catalog No: ARP61079_P050

WB Suggested Anti-ANPEP Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANPEP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ANPEP (ARP61079_P050) antibody is Catalog # AAP61079 (Previous Catalog # AAPP47190)

Target Info

• Gene Symbol: ANPEP
• Gene Full Name: Alanyl (membrane) aminopeptidase
• Alias Symbols: APN, CD13, LAP1, P150, PEPN, GP150
• NCBI Gene Id: 290
• Protein Name: Aminopeptidase N
• Description of Target: Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma.
• Uniprot ID: P15144
• Protein Accession #: NP_001141
• Nucleotide Accession #: NM_001150
• Protein Size (# AA): 967
• Molecular Weight: 106kDa
• Protein Interactions: UBC; ANPEP; Cep76; TM4SF1;