website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ANGPT4 antibody - N-terminal region (ARP56798_P050)

Description of Target:
Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis
Gene Symbol:
Official Gene Full Name:
Angiopoietin 4
NCBI Gene Id:
Alias Symbols:
AGP4; ANG-3; ANG4; MGC138181; MGC138183
Tissue Tool:
Find tissues and cell lines supported to express ANGPT4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-ANGPT4 antibody: synthetic peptide directed towards the N terminal of human ANGPT4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
ANGPT4 antibody - N-terminal region (ARP56798_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-ANGPT4 antibody
- ARP56798_P050
Peptide Sequence:
Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Blocking Peptide:
For anti-ANGPT4 antibody is Catalog # AAP56798 (Previous Catalog # AAPP39713)
Target Reference:
Nakayama,T., (2007) World J. Gastroenterol. 13 (33), 4473-4479
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for ANGPT4 antibody (ARP56798)

Product page for ANGPT4 antibody (ARP56798)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human ANGP4 antibody; Homo sapiens ANGP4 antibody Q9Y264 100%
Human ANGPT4 antibody; Homo sapiens ANGPT4 antibody B4E3J9 100%
Lowland gorilla ANGPT4 antibody; Gorilla gorilla gorilla ANGPT4 antibody G3RL10 100%
Northern white-cheeked gibbon ANGPT4 antibody; Nomascus leucogenys ANGPT4 antibody G1RDZ7 100%
Rhesus macaque ANGPT4 antibody; Macaca mulatta ANGPT4 antibody F6X2C2 92%

Product Protocols: ANGPT4 antibody tested with Human Jurkat Cells (ARP56798_P050)

Aviva Systems Biology is the original manufacturer of this ANGPT4 antibody (ARP56798_P050)

Click here to view the ANGPT4 antibody Western Blot Protocol

Product Datasheet Link: ANGPT4 antibody (ARP56798_P050)

WB Suggested Anti-ANGPT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:

Description of Target: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ANGPT4 antibody (ARP56798_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question