website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ANGPT4 antibody - N-terminal region (ARP56798_P050)

Description of Target:
Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis
Gene Symbol:
Official Gene Full Name:
Angiopoietin 4
NCBI Gene Id:
Alias Symbols:
AGP4; ANG-3; ANG4; MGC138181; MGC138183
Tissue Tool:
Find tissues and cell lines supported to express ANGPT4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-ANGPT4 antibody: synthetic peptide directed towards the N terminal of human ANGPT4
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
ANGPT4 antibody - N-terminal region (ARP56798_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-ANGPT4 antibody
- ARP56798_P050
Peptide Sequence:
Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Blocking Peptide:
For anti-ANGPT4 antibody is Catalog # AAP56798 (Previous Catalog # AAPP39713)
Key Reference:
Nakayama,T., (2007) World J. Gastroenterol. 13 (33), 4473-4479
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ANGPT4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question