SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP59748_P050
Price: $0.00
SKU
ARP59748_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ALDH3A1 (ARP59748_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ALDH3A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALDH3A1 (ARP59748_P050) antibody is Catalog # AAP59748 (Previous Catalog # AAPP45918)
Gene SymbolALDH3A1
Gene Full NameAldehyde dehydrogenase 3 family, member A1
Alias SymbolsALDH3, ALDHIII
NCBI Gene Id218
Protein NameAldehyde dehydrogenase, dimeric NADP-preferring
Description of TargetAldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Uniprot IDP30838
Protein Accession #NP_000682
Nucleotide Accession #NM_000691
Protein Size (# AA)453
Molecular Weight50kDa
Protein InteractionsWWOX; CYHR1; SRF; POT1; ALDH3A1;
  1. What is the species homology for "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig".

  2. How long will it take to receive "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    This target may also be called "ALDH3, ALDHIII" in publications.

  5. What is the shipping cost for "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALDH3A1 Antibody - N-terminal region (ARP59748_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALDH3A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALDH3A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALDH3A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALDH3A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALDH3A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALDH3A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALDH3A1 Antibody - N-terminal region (ARP59748_P050)
Your Rating