Catalog No: ARP59950_P050
Price: $0.00
SKU
ARP59950_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ADORA1 (ARP59950_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ADORA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Rabbit: 82%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: THGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADORA1 (ARP59950_P050) antibody is Catalog # AAP59950 (Previous Catalog # AAPP46113)
Gene SymbolADORA1
Gene Full NameAdenosine A1 receptor
Alias SymbolsRDC7
NCBI Gene Id134
Protein NameAdenosine receptor A1
Description of TargetThe protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate a diverse set of physiologic functions. The type A1 receptors inhibit adenylyl cyclase, and play a role in the fertilization process. Animal studies also suggest a role for A1 receptors in kidney function and ethanol intoxication. Transcript variants with alternative splicing in the 5' UTR have been found for this gene.
Uniprot IDP30542
Protein Accession #NP_000665
Nucleotide Accession #NM_000674
Protein Size (# AA)326
Molecular Weight36kDa
Protein InteractionsSNF8; ATXN1L; EPB41L2; GRM1; P2RY1; GNAI2; GNAS; GNAO1; GNAZ; DRD1; ADA;
  1. What is the species homology for "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADORA1 Antibody - C-terminal region (ARP59950_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    This target may also be called "RDC7" in publications.

  5. What is the shipping cost for "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADORA1 Antibody - C-terminal region (ARP59950_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADORA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADORA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADORA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADORA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADORA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADORA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADORA1 Antibody - C-terminal region (ARP59950_P050)
Your Rating
We found other products you might like!