ADARB2 Antibody - middle region (ARP40918_P050)

Catalog No: ARP40918_P050

WB Suggested Anti-ADARB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Host: Rabbit
Target Name: ADARB2
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADARB2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADARB2 (ARP40918_P050) antibody is Catalog # AAP40918 (Previous Catalog # AAPP22791)
• Reference: Andersen,J.S., (2005) Nature 433 (7021), 77-83

Target Info

• Gene Symbol: ADARB2
• Gene Full Name: Adenosine deaminase, RNA-specific, B2
• Alias Symbols: RED2, ADAR3
• NCBI Gene Id: 105
• Protein Name: Double-stranded RNA-specific editase B2
• Description of Target: ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 DA533361.1 1-48 49-369 AF034837.1 9-329 370-474 AI695657.1 188-292 c 475-2821 AF034837.1 435-2781 2822-3521 AL392083.17 12183-12882 c 3522-3668 BC047443.1 1389-1535
• Uniprot ID: Q9NS39
• Protein Accession #: NP_061172
• Nucleotide Accession #: NM_018702
• Protein Size (# AA): 739
• Molecular Weight: 80kDa
• Protein Interactions: UBC; ANKHD1; GPATCH4; PSME3; PIK3R2; NOP16; SUMO1;