SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60933_P050
Price: $0.00
SKU
ARP60933_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ADAMTS6 (ARP60933_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADAMTS6 (ARP60933_P050) antibody is Catalog # AAP60933 (Previous Catalog # AAPP47218)
Sample Type Confirmation

ADAMTS6 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Gene SymbolADAMTS6
Gene Full NameADAM metallopeptidase with thrombospondin type 1 motif, 6
Alias SymbolsADAM-TS6, ADAMTS-6, ADAM-TS 6
NCBI Gene Id11174
Protein NameA disintegrin and metalloproteinase with thrombospondin motifs 6
Description of TargetThis gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.
Uniprot IDQ9UKP5
Protein Accession #NP_922932
Nucleotide Accession #NM_197941
Protein Size (# AA)1117
Molecular Weight96kDa
Protein InteractionsRNF2; SNTA1;
  1. What is the species homology for "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    This target may also be called "ADAM-TS6, ADAMTS-6, ADAM-TS 6" in publications.

  5. What is the shipping cost for "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "96kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADAMTS6 Antibody - C-terminal region (ARP60933_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADAMTS6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADAMTS6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADAMTS6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADAMTS6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADAMTS6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADAMTS6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADAMTS6 Antibody - C-terminal region (ARP60933_P050)
Your Rating
We found other products you might like!