ADAMDEC1 Antibody - middle region (ARP55070_P050)

Catalog No: ARP55070_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is present in a 39 kDa isoform. The protein may be modified by glycosylation.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADAMDEC1 (ARP55070_P050) antibody is Catalog # AAP55070 (Previous Catalog # AAPP32679)
• Reference: 0

Target Info

• Gene Symbol: ADAMDEC1
• Gene Full Name: ADAM-like, decysin 1
• Alias Symbols: M12.219
• NCBI Gene Id: 27299
• Protein Name: ADAM DEC1
• Description of Target: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i
• Uniprot ID: O15204
• Protein Accession #: NP_055294
• Nucleotide Accession #: NM_014479
• Protein Size (# AA): 470
• Molecular Weight: 53 kDa