SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54586_P050
Price: $0.00
SKU
ARP54586_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACADSB (ARP54586_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACADSB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACADSB (ARP54586_P050) antibody is Catalog # AAP54586 (Previous Catalog # AAPP31370)
ReferenceKamide,K., (2007) J. Hypertens. 25 (1), 103-110
Gene SymbolACADSB
Gene Full NameAcyl-CoA dehydrogenase, short/branched chain
Alias SymbolsACAD7, SBCAD, 2-MEBCAD
NCBI Gene Id36
Protein NameShort/branched chain specific acyl-CoA dehydrogenase, mitochondrial
Description of TargetShort/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-kDa. Sequence Note: The 3' UTR extension represented by the RefSeq transcript record was derived from genomic sequence data to optimize consistency to the reference genome assembly. The extent of the UTR extension and the location of the polyA site was based on transcript alignments.
Uniprot IDP45954
Protein Accession #NP_001600
Nucleotide Accession #NM_001609
Protein Size (# AA)432
Molecular Weight44kDa
Protein InteractionsSUMO2; UBD; UBC; USP19;
  1. What is the species homology for "ACADSB Antibody - middle region (ARP54586_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ACADSB Antibody - middle region (ARP54586_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACADSB Antibody - middle region (ARP54586_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACADSB Antibody - middle region (ARP54586_P050)"?

    This target may also be called "ACAD7, SBCAD, 2-MEBCAD" in publications.

  5. What is the shipping cost for "ACADSB Antibody - middle region (ARP54586_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACADSB Antibody - middle region (ARP54586_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACADSB Antibody - middle region (ARP54586_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACADSB Antibody - middle region (ARP54586_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACADSB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACADSB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACADSB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACADSB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACADSB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACADSB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACADSB Antibody - middle region (ARP54586_P050)
Your Rating
We found other products you might like!