ABI2 Antibody - N-terminal region (ARP61420_P050)

Catalog#: ARP61420_P050

• Size: 50ug

Human Fetal Stomach

• Description of Target: ABI2 may act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. ABI2 is a part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. It regulates ABL1/c-Abl-mediated phosphorylation of MENA.
• Gene Symbol: ABI2
• Alias Symbols: ABI-2; ABI2B; AIP-1; AblBP3; SSH3BP2; argBPIA; argBPIB
• Protein Accession#: NP_005750
• Nucleotide Accession#: NM_005759
• Swissprot Id: Q9NYB9
• Host: Rabbit
• Protein Size (# AA): 475
• Molecular Weight: 52kDa
• Application: WB
• Partner Proteins: ADAM19,ABL1,CCDC53,ENAH,IFT20,KRT15,KRT19,KRT20,NCK2,PCM1,SH3KBP1,SNAP23,VCL,VPS37C,WASF2,ABL1,ADAM19,CCDC53,IFT20,KRT15,KRT19,KRT20,NCK2,PCM1,SH3KBP1,SNAP23,TRAF3IP1,TRIM32,UBC,VCL
• Immunogen: The immunogen for Anti-ABI2 antibody is: synthetic peptide directed towards the N-terminal region of Human ABI2
• Product Format: Lyophilized powder
• Peptide Sequence: Synthetic peptide located within the following region: MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT
• Blocking Peptide: Catalog # AAP61420
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final Anti-ABI2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.