ABCD2 Antibody - N-terminal region (ARP43657_P050)

Catalog No: ARP43657_P050

WB Suggested Anti-ABCD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateABCD2 is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABCD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ABCD2 (ARP43657_P050) antibody is Catalog # AAP43657 (Previous Catalog # AAPP11646)
• Sample Type Confirmation:

  ABCD2 is supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: ABCD2
• Gene Full Name: ATP-binding cassette, sub-family D (ALD), member 2
• Alias Symbols: ALDR, ABC39, ALDL1, ALDRP, hALDR
• NCBI Gene Id: 225
• Protein Name: ATP-binding cassette sub-family D member 2
• Description of Target: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown; however this protein is speculated to function as a dimerization partner of ABCD1 and/or other peroxisomal ABC transporters. Mutations in this gene have been observed in patients with adrenoleukodystrophy, a severe demyelinating disease. This gene has been identified as a candidate for a modifier gene, accounting for the extreme variation among adrenoleukodystrophy phenotypes. This gene is also a candidate for a complement group of Zellweger syndrome, a genetically heterogeneous disorder of peroxisomal biogenesis.
• Uniprot ID: Q9UBJ2
• Protein Accession #: NP_005155
• Nucleotide Accession #: NM_005164
• Protein Size (# AA): 740
• Molecular Weight: 83kDa
• Protein Interactions: UBC; PXA1; PXA2; ABCD2; PEX19; ABCD1; ABCD3;